KEGG   Chromohalobacter salexigens: Csal_3279Help
Entry
Csal_3279         CDS       T00347                                 

Definition
(GenBank) porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
csa  Chromohalobacter salexigens
Pathway
csa00860  Porphyrin and chlorophyll metabolism
csa01100  Metabolic pathways
csa01110  Biosynthesis of secondary metabolites
csa01120  Microbial metabolism in diverse environments
Module
csa_M00121  Heme biosynthesis, glutamate => heme
Brite
KEGG Orthology (KO) [BR:csa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Csal_3279
Enzymes [BR:csa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Csal_3279
Exosome [BR:csa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Csal_3279
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: ABE60623
JGI: Csal3279
UniProt: Q1QSD5
Position
complement(3655469..3656503)
Genome map
AA seq 344 aa AA seqDB search
MLAAPSEWSAACHRPSKEFYMPAQFPQARLRRLRRTSSLRDIVRETSLRPEHLVYPIFVE
EDADDFVPIEGMPGQYRVPENQLAAEVKRLSELGLRGIMPFGISHHKDADGSDAMDDNGL
VSRMVRIIKTAAPEMVVIPDICFCEYTTHGHCGILKGDTVDNDLTIRNLGIQAVAAAKAG
ADIIAPSAAQDGQVAAIRGALDEAGFEDIPIMAYSTKLASALYGPFREAAGTELKGDRHT
YQMDPMNRREALRESLADEAEGADFLMVKPALAYLDIMADIRRNSLLPLVAYQVSGEYAM
IRMAAQQGVIDEAAVIRETLGSMRRAGADLIMTYFAPQLLEEGL
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgctcgccgcgccatcggagtggtcggcggcatgccaccgaccatccaaggagttctac
atgcctgctcagtttccccaggcccgtctgcggcgcttgcggcgtacctcctcgctgcgt
gacatcgtgcgtgaaacctcgctgcgtccggagcatctggtgtatccgatcttcgtggag
gaagacgcggacgacttcgtgcccatcgaggggatgccgggtcagtatcgcgttccggaa
aatcagctggcggcggaagtgaaacgtctcagcgagctgggtctcaggggcatcatgccg
ttcggcatttcgcatcacaaggatgccgacggcagcgatgccatggacgacaacggcctg
gtgtcgcgcatggtacgcatcatcaagacggccgcgccggagatggtggtgattcccgat
atctgcttctgcgagtacaccacacacgggcattgcggcatcctcaagggtgacaccgtc
gacaacgacctgaccatccgcaatctcggcattcaggccgtggcggctgccaaggcgggg
gccgacatcatcgcgccttcggcggcccaggacggccaggtggcggcgattcgcggcgcg
ctcgacgaggccggtttcgaagacattcccatcatggcgtattccaccaagctggcctcg
gcgctctacggccccttccgcgaggcggcgggcaccgaactcaagggcgatcgccacacc
tatcagatggatcccatgaaccgtcgcgaggcgctgcgcgagtcgctggccgacgaggcc
gaaggggccgatttcctgatggtcaagccggcgctggcgtatctcgacatcatggcggac
attcgccgcaacagcctgttgccgctggtggcgtatcaggtcagcggcgaatacgcgatg
atccgcatggccgcgcagcaaggcgtgatcgacgaggcggcggtgatccgcgagacgctg
ggctccatgcggcgcgcgggggccgatctgatcatgacctacttcgccccgcaattgctc
gaggaaggcctgtag

DBGET integrated database retrieval system