KEGG   Chlorocebus sabaeus (green monkey): 103234346Help
Entry
103234346         CDS       T04361                                 

Gene name
INSR
Definition
(RefSeq) insulin receptor
  KO
K04527  insulin receptor [EC:2.7.10.1]
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab04010  MAPK signaling pathway
csab04014  Ras signaling pathway
csab04015  Rap1 signaling pathway
csab04022  cGMP-PKG signaling pathway
csab04066  HIF-1 signaling pathway
csab04068  FoxO signaling pathway
csab04072  Phospholipase D signaling pathway
csab04150  mTOR signaling pathway
csab04151  PI3K-Akt signaling pathway
csab04152  AMPK signaling pathway
csab04211  Longevity regulating pathway
csab04213  Longevity regulating pathway - multiple species
csab04520  Adherens junction
csab04910  Insulin signaling pathway
csab04913  Ovarian steroidogenesis
csab04923  Regulation of lipolysis in adipocytes
csab04930  Type II diabetes mellitus
csab04931  Insulin resistance
csab04932  Non-alcoholic fatty liver disease (NAFLD)
csab04960  Aldosterone-regulated sodium reabsorption
Module
csab_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:csab00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    103234346 (INSR)
   04015 Rap1 signaling pathway
    103234346 (INSR)
   04010 MAPK signaling pathway
    103234346 (INSR)
   04066 HIF-1 signaling pathway
    103234346 (INSR)
   04068 FoxO signaling pathway
    103234346 (INSR)
   04072 Phospholipase D signaling pathway
    103234346 (INSR)
   04022 cGMP - PKG signaling pathway
    103234346 (INSR)
   04151 PI3K-Akt signaling pathway
    103234346 (INSR)
   04152 AMPK signaling pathway
    103234346 (INSR)
   04150 mTOR signaling pathway
    103234346 (INSR)
 Cellular Processes
  Cellular community - eukaryotes
   04520 Adherens junction
    103234346 (INSR)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    103234346 (INSR)
   04923 Regulation of lipolysis in adipocyte
    103234346 (INSR)
   04913 Ovarian Steroidogenesis
    103234346 (INSR)
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    103234346 (INSR)
  Aging
   04211 Longevity regulating pathway - mammal
    103234346 (INSR)
   04213 Longevity regulating pathway - multiple species
    103234346 (INSR)
 Human Diseases
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    103234346 (INSR)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    103234346 (INSR)
   04931 Insulin resistance
    103234346 (INSR)
Enzymes [BR:csab01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     103234346 (INSR)
Protein kinases [BR:csab01001]
 Receptor tyrosine kinases
  INSR family [OT]
   103234346 (INSR)
Cytokine receptors [BR:csab04050]
 Receptor tyrosine kinase
  RTK class II (Insulin receptor family)
   103234346 (INSR)
CD molecules [BR:csab04090]
 Proteins
  103234346 (INSR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Recep_L_domain Pkinase Furin-like fn3 Kinase-like DUF4476 B2
Motif
Other DBs
NCBI-GeneID: 103234346
NCBI-ProteinID: XP_007994255
Ensembl: ENSCSAG00000008965
Position
6
AA seq 1338 aa AA seqDB search
MGTGGRRGTAAAPLLVAVAALLLGAAGHLYPGEVCPGMDIRNNLTRLHELENCSVIEGHL
QILLMFKTRPEDFRDLSFPKLIMITDYLLLFRVYGLESLKDLFPNLTVIRGSRLFFNYAL
VIFEMVHLKELGLYNLMNITRGSVRIEKNNELCYLATIDWSRILDSVEDNYIVLNKDDNE
ECGDICPGTAKGKTNCPATVINGQFVERCWTHSHCQKVCPTICKSHGCTAEGLCCHSECL
GNCSEPDDPTKCVACRNFYLDGRCVETCPPPYYHFQDWRCVNFSFCQDLHHKCKNSRRQG
CHQYVIHNNKCIPECPSGYTMNSSKLYRTVAFSNVKPTEYSLLSLDNLAAELEANLGLIE
EISGYLKIRRSYALVSLSFFRKLRLIRGETLEIGNYSFYALDNQNLRQLWDWSKHNLTIT
QGKLFFHYNPKLCLSEIHKMEEVSGTKGRQERNDIALKTNGDQASLSVLPHQAHELKCDG
LIKVTALLFCLDSPYQNVTEFDGQDACGSNSWTVVDIDPPLRSNDPKSQNHPGWLMRGLK
PWTQYAIFVKTLVTFSDERRTYGAKSDIIYVQTDATNPSVPLDPISVSNSSSQIILKWKP
PSDPNGNITHYLVFWERQAEDSELFELDYCLKGLKLPSRTWSPPFESEDSQKHNQSEYED
SAGECCSCPKTDSQILKELEESSFRKTFEDYLHNVVFVPRKTSSGTGAEDPRPSRKRRSL
GDIGNVTVAVPTVAAFPNTSSTSTPTSPEEHRPFEKVVNKESLVISGLRHFTGYRIELQA
CNQDTPEERCSVAAYVSARTMPEAKADDIVGPVTHEIFENNIVHLMWQEPKEPNGLIVLY
EVSYRRYGDEELHLCVSRKHFALERGCRLRGLSPGNYSVRVRATSLAGNGSWTEPTYFYV
TDYLDVPSNIAKIIIGPLIFVFLFSIVIGSIYLFLRKRQPDGPLGPLYASSNPEYLSASD
VFPCSVYVPDEWEVPREKITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESAS
LRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAEN
NPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDI
YETDYYRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQ
VLKFVMDGGYLDQPDNCPERVTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSFPEVSFF
HSEENKAPESEELEMEFEDMENVPLDRSSHCQREEAGGRDGGSSLGFKRSYEEHIPYTHM
NGGKKNGRILTLPRSNPS
NT seq 4017 nt NT seq  +upstreamnt  +downstreamnt
atgggcaccgggggccggcgggggacagctgccgcgccgctgctggtggcggtggccgcg
ctgctactgggcgccgcgggccacctgtaccccggagaggtgtgtcccggcatggatatc
cggaacaacctcaccaggttacacgagctggagaattgctctgtcatcgaaggacacttg
cagatactcttgatgttcaaaacgaggcccgaagatttccgagacctcagtttccccaaa
ctcataatgatcactgattacctgctgctcttccgggtctatgggctcgagagcctgaag
gacctgttccccaacctcacggtcatccggggatcacgactgttctttaactacgcgctg
gtcatcttcgagatggttcacctcaaggaacttggcctctacaatctaatgaacatcacc
cggggttctgtccgcatcgagaagaacaatgagctctgttacttggccactatcgactgg
tcccgcatcctggattccgtggaggataattacatcgtgttgaacaaagatgacaacgag
gagtgtggagacatctgtccgggtacagcgaagggcaagaccaactgccccgccactgtc
atcaatgggcagtttgtcgaacggtgttggactcatagtcactgccagaaagtttgccca
accatctgtaagtcacacggctgcactgccgaaggcctctgttgccacagcgagtgcctg
ggcaactgttctgaacccgacgaccccaccaagtgcgtggcctgccgcaacttctacctg
gacggcaggtgtgtggagacctgcccgcccccgtactaccacttccaggactggcgctgt
gtgaacttcagcttctgccaggacctgcaccacaaatgcaagaactcgcggaggcagggc
tgccaccagtacgtcattcataacaacaagtgcatccctgagtgtccctccgggtacacg
atgaattccagcaaactttataggactgtggcattttcgaatgtgaaacccactgaatat
tctctcctttccttagataatctggcagctgagctagaagccaacctcggcctcattgaa
gaaatttcagggtatctgaaaatccgccgatcctacgctctggtgtcactttctttcttc
cggaagttacgcctgattcgaggagagaccttggaaatcgggaactactccttctatgcc
ttggacaaccagaacctaaggcagctctgggattggagcaaacacaacctcaccatcact
caggggaaactcttcttccactataaccccaaactctgcttgtcagaaatccacaagatg
gaagaagtttcaggaaccaaggggcgccaggagagaaatgacattgccctgaagacaaat
ggggaccaggcatccttgtcagttctgccacatcaggcccatgagctcaagtgtgacggt
cttataaaggtaaccgccttgctgttttgtcttgacagcccttaccagaacgtgacggag
tttgacgggcaggacgcgtgtggttccaacagctggacggtggtagacattgacccgccc
ctgaggtccaatgaccccaaatcacagaaccacccaggatggctaatgcggggtctcaag
ccctggacccagtatgccatctttgtgaagaccctggtcaccttttcggatgaacgccgg
acctacggagccaagagtgacatcatttatgtccagacagatgccaccaacccctccgtg
cccctggatccaatctcagtgtctaactcatcatcccagattattttgaagtggaaaccc
ccctccgaccccaacggcaacatcacccactacctggttttctgggagaggcaggcggaa
gacagtgagctgttcgagctggattattgcctcaaagggctgaagctgccctccaggacc
tggtctccaccattcgagtctgaagattctcagaagcacaaccagagtgaatatgaggat
tcagccggtgaatgttgctcctgtccaaagacagactctcagatcctgaaggagctggag
gagtcctcgtttaggaagacgtttgaggattacctgcacaatgtggttttcgtccccaga
aaaacctcttcaggcactggtgccgaggaccctagaccatctcggaaacgcaggtccctt
ggcgatattgggaatgtgacggtggccgtgcccacggtggcagctttccccaacacttcc
tcgaccagcacgcccacgagtccagaggagcacaggccctttgagaaggtggtgaacaag
gagtcgctggtcatctccggcttgcgacacttcacgggctatcgcatcgagctgcaggct
tgcaaccaagacacccctgaggaacggtgcagtgtggcagcctacgtcagcgccaggacc
atgcctgaagccaaggctgatgacattgttggccctgtgacacatgaaatctttgagaac
aacattgtccacttgatgtggcaggagccgaaggagcccaatggtctgattgtgctgtat
gaagtgagttatcggcgatatggcgatgaggagctgcatctttgtgtctcccgcaagcac
ttcgctctggaacggggctgcaggctgcgcgggctgtcgccggggaactacagcgtgcga
gtccgggccacctccctcgcgggcaatggctcctggacggaacccacctatttctacgtg
acggactatttagatgtcccgtcaaatattgcaaaaattatcatcggccccctcatcttt
gtctttctcttcagtattgtgattggaagtatttatctattcctgagaaagaggcagcca
gatgggcctctgggaccgctttacgcttcttcaaaccctgagtatctcagtgccagtgat
gtgtttccatgctctgtgtacgtgccggacgagtgggaggtgcctcgagagaagatcacc
ctccttcgagagctggggcagggctccttcggcatggtatatgagggcaacgccagggac
atcatcaagggtgaggcagagacccgcgtggcagtgaagacggtcaacgagtcagccagt
ctccgagagcggattgagttcctcaatgaggcctcggtcatgaagggcttcacctgccat
catgtggtgcgcctcctgggagtggtgtccaagggccagcccacgctggtggtgatggag
ctgatggctcacggagacctgaagagctacctccgttctctgcggccagaggctgagaat
aatcctggccgccctccccctaccctgcaagagatgattcagatggcggcagagattgct
gacgggatggcctacctgaatgccaagaagtttgtgcatcgggacctggcagcgagaaac
tgcatggttgcccacgattttactgtcaaaattggagacttcggaatgaccagagacatc
tatgaaacggattactaccggaaagggggcaagggtctgctccctgtacggtggatggcg
ccggagtccctgaaggatggggtctttaccacttcttctgacatgtggtcctttggcgtg
gtcctttgggaaatcaccagcttggcagaacagccttaccaaggcctgtctaatgaacag
gtgttgaaatttgtcatggacggagggtatctggatcaacccgacaactgtccagagaga
gtcactgacctcatgcgcatgtgctggcaattcaaccccaagatgaggccaacctttctg
gagatcgtcaacctgctcaaggacgacctgcaccccagctttccggaggtgtcgttcttt
cacagcgaggagaacaaggctcccgagagtgaggagctggagatggagtttgaggacatg
gagaacgtgcccctggaccgttcctcgcactgtcagagggaggaggcggggggccgggat
ggagggtcctcgctgggtttcaagcggagctacgaggaacacatcccttacacccacatg
aacggaggcaagaaaaacgggcggattctgaccttgcctcggtccaatccttcctaa

DBGET integrated database retrieval system