KEGG   Camelina sativa (false flax): 104714601Help
Entry
104714601         CDS       T05044                                 

Definition
(RefSeq) acid beta-fructofuranosidase 3, vacuolar isoform X1
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
csat  Camelina sativa (false flax)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csat00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    104714601
   00500 Starch and sucrose metabolism
    104714601
Enzymes [BR:csat01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     104714601
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
9
AA seq 648 aa AA seqDB search
MASTEALLPVTSRQDPLSESRSDQIPETRRRRPIKVHLAVCSGLLLIALYVTLIVTHDGS
TAQNGAKDETSTESRARLAGVSEKSNDGVWKLSGDGKTEAFPWNNTMLSWQRTAFHFQPE
KNWMNDPNGPLFYKGWYHFFYQYNPNAAVWGDIVWGHAVSKDLIHWLYLPLAMVPDQWYD
ANGVWTGSATFLDDGSIVMLYTGSTDKFVQVQNLAYPEDPSDPLLLKWTKFSGNPVLVPP
PGIGAKDFRDPTTAWKTSSGKWRITIGSKINRTGISLVYDTTDFKTYEKHETLLHQVPNT
GMWECVDFYPVSKTKINGLDTSVKGPDVKHIVKASMDDTRIDHYAIGTYDDSNGTWVPDN
PSIDVGISTGLRYDYGKFYASKTFYDQNKKRRILWGWIGESDSEAADVQKGWSSVQGIPR
TVVLDTKTGKNLVQWPVEEIKSLRLSNKKFHMKVGPGTVVPIDVGSAAQLDIEAEFKIKK
DDLEIILGEDSVEADEEFSCQNGGGSTVRGALGPFGFSVLADQSLSEHTPVYFYVTKGKD
SKLKTFFCTDTSRSTMANDVVKPVYGSFVPVLKEEKLTMRILVDHSIVEGFAQGGRTCIT
SRVYPTKAIYGATKLFLFNNAIDATVTASFKVWQMNGAFIHPYPADDL
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcacggaagctcttttacccgtcacgtcccgacaagatccattatccgaatca
agatccgaccagatcccggagactcgtcggagaagacccatcaaagtccatctagctgtc
tgttccggtttgctcttgatcgctttgtacgtaactctcatcgtcacgcacgacggatcc
accgcacaaaacggcgccaaggatgaaacatccacggagtcacgtgctcgtttggcaggc
gtgtcggagaagagcaacgacggggtttggaaattatccggggatggtaaaactgaagcg
ttcccatggaacaatactatgttgtcatggcaacgtacggcgtttcatttccagcctgaa
aaaaattggatgaacgatcctaacggtccattgttctataagggatggtaccatttcttc
tatcaatacaatccaaatgcagctgtgtggggtgacattgtttggggtcacgccgtgtca
aaggacctaatccattggctttaccttccattagccatggttcctgatcaatggtacgac
gcgaacggcgtctggactggttcagccacttttctagatgatggctccattgtcatgctc
tacaccggttccactgacaaattcgtacaggttcaaaaccttgcctatcctgaggaccca
agcgacccacttttactgaaatggaccaagttctctggcaacccggttctcgtaccgcct
ccaggtattggtgcaaaggacttccgtgacccaaccacagcctggaagacatcgtctgga
aaatggcgaatcaccatcggctctaaaatcaatagaaccggaatatctctcgtatatgac
accaccgatttcaaaacctacgagaaacatgagactttgttgcaccaagtccccaacacc
ggaatgtgggagtgtgttgatttttacccggtgtccaagactaaaatcaatgggctcgat
acttcggtcaaaggaccagatgtaaagcatatcgtgaaggctagcatggacgatacaaga
attgatcattatgccattgggacttatgatgattcaaacggtacatgggtcccggataat
ccttctatcgatgttggaatcagtaccggtttgagatacgattacgggaaattctatgcg
tcaaagacgttttacgatcaaaataagaaaaggagaatcttatggggttggatcggtgaa
tctgacagtgaagctgctgatgtacagaagggttggtcatccgttcagggcatcccaaga
actgttgtcttggacacgaagaccgggaaaaacttagtccaatggccagttgaggaaatc
aaatctttgagactaagtaacaagaaattccacatgaaggttggaccagggacggtggtt
ccgattgacgtgggttccgcggctcagctagatatagaggcggaattcaagatcaagaag
gacgatctcgaaataatccttggagaagactccgtagaggctgacgaggaattcagctgc
caaaacggcggtggatccaccgtgcgtggggctttaggacctttcggattctcggttctc
gctgaccaaagcttgtcagaacacactccagtttacttctacgtgactaagggaaaagat
tcaaaactcaagactttcttctgcactgacacttcaaggtcgaccatggcaaacgatgtg
gtgaaaccagtgtatggaagcttcgtaccggtcctaaaagaagagaaattgacaatgaga
atcttggtggatcattcgatagtagaaggattcgcacaaggtggaagaacatgtatcacc
tcaagagtatatcccacaaaagccatatatggagctacaaagctcttcttgttcaataac
gctattgatgcaaccgttactgcgtcgtttaaggtctggcaaatgaacggtgcttttatt
catccttaccctgccgacgatctttga

DBGET integrated database retrieval system