KEGG   Camelina sativa (false flax): 104769427Help
Entry
104769427         CDS       T05044                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme CWINV6 isoform X1
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
csat  Camelina sativa (false flax)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csat00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    104769427
   00500 Starch and sucrose metabolism
    104769427
Enzymes [BR:csat01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     104769427
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
20
AA seq 551 aa AA seqDB search
MAKHGNVQDLLPNQVLNRTSFHFQPQRNWLNDPNAPMYYKGFYHLFYQNNPLAPEFSRKK
MIWGHSVSQDMVNWIQLEPALSPSEPYDINSCWSGAATILPDGRPVILYTGLDNNNRTQV
TVVAEPKDVSDPLLREWVKPKYNPVMVPPSNVYHDCFRDPTTAWQGEDGIWRVLIGAKVK
DTETGMAILYRSDDFVKWTKYPVNLLEAEETGMWECPDFFPVSITGKEGVDTSVNNANVR
HVLKASFGGNDCYVIGKYSSENEEFLGDYEFTKTSADLRYDHGTFYASKAFFDSVKNRRI
NWGWVVETDSKEDDFKKGWAGLMTLPREMWLDTSGKRLIQWPIEEINHLRTKSVKLDSCE
IKTGAAFEISGITAAQADVEVTFNLPSLEDNPEILEADHHVDDATLFDRDSSVGCVYGPF
GLLALASDDLSEQTAIFFKVIRRGNGYAVVMGSNEKRSSLRDNVKKSSHGTFVDINPRQE
KISLRCLIDHSIIESYAAGGKSVITSRVYPKLAIGEAAKLYVFNDGTRGVTMSSLEAWSM
RNAQINTNTTY
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggctaaacatggaaacgtccaagatcttcttccaaaccaagtgcttaaccggacttcc
ttccatttccaaccgcagagaaattggctcaacgatccaaacgcgccaatgtactacaaa
ggattctaccatttgttctaccagaacaaccctttggcccctgagttcagtaggaagaag
atgatatggggacactctgtttcacaagatatggtcaactggatccaacttgagccagcc
ctttctccctctgagccctatgacatcaacagctgctggtcaggagccgccacgatcctc
cctgatggcagacctgtaattttgtacactggactcgacaacaacaacagaacacaagtc
acagttgttgccgaaccaaaggacgtttctgaccctttgcttcgtgagtgggttaagcca
aagtacaatcctgtgatggttccgccaagtaatgtctatcatgattgtttccgtgatcca
acaacggcgtggcaaggggaagatgggatttggagagtgctcattggagctaaggtgaaa
gatactgagacaggaatggccattttgtaccgaagcgatgattttgtcaagtggacaaag
tatcctgtgaatttacttgaggcagaagaaaccggaatgtgggaatgccctgatttcttc
ccggtttccatcactggtaaagaaggtgtagatacttcggtgaacaacgctaacgtgagg
catgtcttgaaggccagttttggaggcaatgattgctatgtcattggtaaatactcttct
gagaatgaggagtttttaggggattatgagttcactaagacgagtgctgatttgagatat
gatcatggaacgttttatgcgtcaaaggcgtttttcgatagtgttaagaatcggaggatc
aactggggatgggttgtagagactgatagcaaagaagatgatttcaagaaaggatgggct
ggccttatgactcttcccagggaaatgtggctggacacaagtggaaagaggctgatacaa
tggccaattgaagaaatcaaccatctccggactaaaagtgttaaactcgatagctgtgaa
atcaaaaccggtgcggcctttgaaatctctggcatcactgctgcccaagccgacgtagaa
gtgacttttaatctgccatcactggaagataaccccgagatactggaggctgatcaccat
gttgatgatgcgactctgttcgatcgtgacagctctgttggatgcgtttacgggcctttt
ggtttgctagcattggctagcgatgatttatctgaacaaaccgcaatcttctttaaagtc
atccgacgtggaaacggatatgcagttgtaatgggcagcaacgagaagaggtcttcgttg
agagacaacgtaaagaaatcttcgcatggaacattcgtagacattaatccaaggcaggag
aaaatctcattaagatgtttgatcgatcactctattatagagagctacgcagctggagga
aaaagtgtgataacatcaagggtttatcccaaattggcaattggtgaagcagctaagctt
tatgtgttcaatgatggaacaaggggtgtgaccatgtcgtctttagaagcttggagcatg
agaaatgcccaaatcaatacaaacacaacttattaa

DBGET integrated database retrieval system