KEGG   Camelina sativa (false flax): 104792762Help
Entry
104792762         CDS       T05044                                 

Definition
(RefSeq) caffeoylshikimate esterase
  KO
K01054  
acylglycerol lipase [EC:3.1.1.23]
Organism
csat  Camelina sativa (false flax)
Pathway
Glycerolipid metabolism
Metabolic pathways
Module
Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:csat00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    104792762
Enzymes [BR:csat01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     104792762
Peptidases [BR:csat01002]
 Serine Peptidases
  Family S33
   104792762
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
6
AA seq 311 aa AA seqDB search
MVLYEEGFILNSRGMKLFTCVWKPDKEEPKAFLFLCHGYAMESSITMNSSATRLAKAGFA
VYGMDYEGHGKSEGLNGYISDFDRLVDDVSNHYSSICEKEENKGKMRFLLGESMGGALAL
LLARKKPDFWDGAVLVAPMCKLADEVKPHPVVISILIKLAKFIPTWKIVPGNDIIDIAVK
EAHIRKQVRENKYCYKGRPRLNTAYQLLLVSLDLEKNLHQVSIPFIVLHGEDDKVTDKSV
SKLLYEVASSSDKTFKLYPNMWHALLYGETPENSEIVFGDIINWLEDRAINSNGGLETQL
KHKHDGFLTHK
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggttctgtatgaagagggttttatattgaactcacgaggcatgaagctgttcacttgt
gtatggaaaccagataaggaagaaccaaaggcctttctcttcctctgccatggctacgct
atggagtccagcatcaccatgaacagttcagccacgaggctagccaaggccggttttgca
gtctatggaatggactatgaaggacacgggaaatccgagggactaaatggttatatcagt
gactttgatcgtctcgttgatgatgtctcaaatcactactcttcaatttgtgagaaggaa
gagaacaaggggaagatgaggtttctacttggagaatccatgggaggagcacttgcgttg
ctcttagccagaaagaagcctgacttttgggacggtgcggttttggtcgcacccatgtgt
aagttagcagacgaggtaaagccacatccagtagtgatctcaattcttatcaagcttgcc
aagtttattccgacgtggaaaatagttccaggaaatgatatcattgacattgcagttaaa
gaagcccacatcagaaaacaggtgagggagaacaagtattgctataaaggccggcctcgc
ctcaataccgcctaccaactcttgttggttagcttggatctcgagaagaatcttcatcag
gtatctattccttttattgttcttcacggggaagatgataaagtgacggacaaaagcgtg
agcaaattgctatacgaagtggcttcaagctcggacaagacgttcaagttgtaccccaac
atgtggcacgctttgctatacggggaaactcctgaaaattcagaaattgtgtttggtgat
atcataaattggctggaggatagagccatcaattcgaacggagggttggagactcagcta
aaacataagcatgatggattcttgacgcataaataa

DBGET integrated database retrieval system