KEGG   Clostridium saccharobutylicum: CLSA_c05080Help
Entry
CLSA_c05080       CDS       T02876                                 

Gene name
thlA
Definition
(GenBank) acetyl-CoA acetyltransferase ThlA
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
csb  Clostridium saccharobutylicum
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:csb00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CLSA_c05080 (thlA)
   00630 Glyoxylate and dicarboxylate metabolism
    CLSA_c05080 (thlA)
   00640 Propanoate metabolism
    CLSA_c05080 (thlA)
   00650 Butanoate metabolism
    CLSA_c05080 (thlA)
  Lipid metabolism
   00071 Fatty acid degradation
    CLSA_c05080 (thlA)
   00072 Synthesis and degradation of ketone bodies
    CLSA_c05080 (thlA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CLSA_c05080 (thlA)
   00310 Lysine degradation
    CLSA_c05080 (thlA)
   00380 Tryptophan metabolism
    CLSA_c05080 (thlA)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CLSA_c05080 (thlA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CLSA_c05080 (thlA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CLSA_c05080 (thlA)
Enzymes [BR:csb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CLSA_c05080 (thlA)
Exosome [BR:csb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CLSA_c05080 (thlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
530883..532064
Genome map
AA seq 393 aa AA seqDB search
MRDVVIVSAVRTALGSFGGALKTVPAVDLGALVIKEAVNRAGVKPEVVEEVIMGNVIQAG
LGQNTARQAAVKSGLPVEVPAMTINKVCGSGLRAVSLAAQMIKAGDADVVVAGGMENMSA
APYALDKARWGQRMGDGKLVDTMIKDGLWDAFNNYHMGVTAENIAKEWGLTREEQDEFSA
ASQQKAEAAIKSGRFKDEIVPVVIPQRKGEPKVFDTDEFPRFGTTVETLAKLKPAFIKDG
TVTAGNASGINDGAAAFVVMSAEKAQQLGLKPLAKILSYGSRGLDPAIMGYGPFHATKKA
LEAANLTVEDLDLIEANEAFAAQSLAVAKDLKFDMSKVNVNGGAIALGHPVGASGARILV
TLLHEMEKRDAKKGLATLCIGGGMGTALVVERV
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgagagatgtagttattgtaagtgcagtaagaacagcattaggaagttttggtggagca
ttaaaaacagttccagcagtagacttaggagctttagtaattaaagaagctgtaaacaga
gccggagttaaaccagaagtagttgaagaagttatcatgggtaatgtaattcaagcaggt
cttggtcaaaacactgcaagacaagcagcagttaaatcaggattaccagttgaagttcca
gctatgacaataaataaagtttgcggatcaggtttaagagcagttagtttagcagctcaa
atgattaaagctggagatgctgacgttgttgttgcaggtggtatggaaaacatgtcagct
gctccatatgcattagataaggcaagatggggacaaagaatgggcgacggtaaattagtt
gacacaatgataaaagatggattatgggatgcattcaataactaccatatgggagttaca
gctgaaaatatagctaaagaatggggattaactagagaagaacaagatgaattttcagca
gcatcacaacaaaaagctgaagcagcaattaaatcaggaagatttaaagatgaaatagta
ccagttgttatccctcaaagaaaaggggaaccaaaggtatttgatacagatgaattccca
agattcggaacaactgtagaaactttagctaaattaaaaccagcatttataaaagatggt
acagtaactgcaggtaatgcttcaggaattaatgatggggcagcagcatttgttgtaatg
agtgcagaaaaagctcaacaactaggacttaagccattagctaaaattctttcttatgga
tcaaggggattagatccagctataatgggatacggaccattccatgcaactaagaaagct
ttagaagcagctaacctaactgttgaagatttagatttaatcgaagctaatgaagctttt
gcagctcaaagtttagctgttgctaaagatttaaaattcgatatgtcaaaagtaaacgta
aatggtggagcaattgctttgggtcatccagtaggagcatcaggagcaagaatcttagtt
actcttcttcatgaaatggaaaagagagatgctaaaaagggattagcaacactttgtata
ggtggaggaatgggaactgcacttgtagttgaaagagtttaa

DBGET integrated database retrieval system