KEGG   Clostridium saccharobutylicum: CLSA_c15870Help
Entry
CLSA_c15870       CDS       T02876                                 

Gene name
rbsK
Definition
(RefSeq) ribokinase RbsK (EC:2.7.1.15)
  KO
K00852  
ribokinase [EC:2.7.1.15]
Organism
csb  Clostridium saccharobutylicum
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:csb00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CLSA_c15870 (rbsK)
Enzymes [BR:csb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     CLSA_c15870 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1776214..1777155
Genome map
AA seq 313 aa AA seqDB search
MNKVCVLGSINMDLVFQIENMPKEGETILSKQFDKNPGGKGANQAVAAKRSGASVYMIGK
IGNDDNGRTMVEGLENDGINTKYISIDPNEPTGMAIIMVNSQGNNSIVVEAGANMNIDNN
DIKNADEAIINSDIIISQFETPDQSAIEAFKRAKELNKITILNPAPAKKIEDELLKYTDI
IVPNETEVEVITGVKVFDLESAKNAGQLLIEKGIKYVIITLGEKGAALISKDRAEIVQAF
KVNAVDTTAAGDSFIGGISCKIDVNEFSFESLLKSIRFGNMVSSLAVQKEGAQISIPYLN
DVLEVYKDKEELK
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaagtttgtgttttgggaagcataaatatggatttagtttttcaaattgaaaat
atgcctaaagagggcgaaactatattatcaaaacaattcgataaaaatccagggggaaag
ggcgctaatcaggcagtagcggcaaaaagatctggagccagtgtttatatgataggtaag
attggaaatgatgataatggaagaactatggttgaaggattagaaaatgacggtataaat
acaaagtatatttcaattgatccgaatgaaccaacaggaatggcaattataatggttaat
agtcaagggaataactccatagttgttgaagctggtgctaacatgaatatagataataat
gatatcaaaaatgcagatgaggcaattattaatagtgatattataatttctcaatttgaa
actccagatcaatctgcaattgaagcatttaaaagagctaaggagttaaataagataact
atattaaatccagcaccagccaaaaaaatagaagatgaattattaaaatatacagatata
atagttcctaatgaaacagaagttgaagtaattactggtgtaaaagtttttgatttagaa
agtgcaaaaaacgcaggtcaattattaatagaaaaaggtattaagtatgtaattataact
ttaggcgaaaaaggagcagcgcttatttcaaaggatagagcagaaatagtacaagcattt
aaagttaatgcagtggatactacagcagcaggtgatagttttattgggggaataagttgt
aaaattgatgttaatgaattttcatttgaaagtttactcaaatcaatcagatttgggaat
atggtttcatcattagcagttcaaaaagaaggagctcaaatttcaattccatatttaaat
gatgtattagaagtgtataaggataaggaggagttaaaatga

DBGET integrated database retrieval system