KEGG   Clostridium saccharobutylicum: CLSA_c19890Help
Entry
CLSA_c19890       CDS       T02876                                 

Gene name
xynB
Definition
endo-1,4-beta-xylanase XynB (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
csb  Clostridium saccharobutylicum
Brite
Enzymes [BR:csb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     CLSA_c19890 (xynB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2246848..2247633
Genome map
AA seq 261 aa AA seqDB search
MLRRKVIFTVLATLVMTSLTIVDNTAFAATNLNTTESTFSKEVLSTQKTYSAFNTQAAPK
TITSNEIGVNGGYDYELWKDYGNTSMTLKNGGAFSCQWSNIGNALFRKGKKFNDTQTYKQ
LGNISVNYDCNYQPYGNSYLCVYGWTSSPLVEYYIVDSWGSWRPPGGTSKGTITVDGGIY
DIYETTRINQPSIQGNTTFKQYWSVRRTKRTSGTISVSKHFAAWESKGMPLGKMHETAFN
IEGYQSSGKADVNSMSINIGK
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgttgagaagaaaagtaatttttactgttttagcaacattagttatgacaagtttaact
atagttgacaatactgcttttgcagcaacaaatttaaacacaacagaaagtacttttagt
aaagaagttttaagtacgcaaaaaacttattcagcatttaacacacaggcagcaccaaaa
acgattacctcaaatgaaattggtgttaatggcggctacgactatgaactttggaaggac
tatggaaacaccagtatgacgttgaagaatggtggcgcgtttagttgtcaatggagtaat
atcggaaatgcattattccgtaaaggcaagaaattcaatgatacccagacatacaaacag
cttggaaatatatcagtaaactatgattgcaattatcagccatatggcaattcctatttg
tgtgtatatggatggacgagtagtcctcttgtagaatattatatagttgatagctggggc
agctggagaccacctggcggaacatcaaagggtacaattacagtcgatggtggtatctat
gacatatatgagaccactcgaatcaaccagccttcaattcaaggcaatacaacttttaag
cagtattggagtgtccgcagaactaaacgaactagcggaacaatatctgtcagcaaacac
tttgccgcttgggaaagtaaaggaatgccacttggaaaaatgcatgaaactgcatttaac
atagaggggtaccaaagcagtggcaaagctgatgtgaatagtatgtcaattaacattgga
aaataa

DBGET integrated database retrieval system