KEGG   Clostridium saccharobutylicum: CLSA_c27700Help
Entry
CLSA_c27700       CDS       T02876                                 

Definition
L-ribulose-5-phosphate 4-epimerase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
csb  Clostridium saccharobutylicum
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:csb00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    CLSA_c27700
Enzymes [BR:csb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     CLSA_c27700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3097043..3097660)
Genome map
AA seq 205 aa AA seqDB search
MLENLRIKLVKIAKEAEKYGLCKEKTGSFSIKDKTTGYVLITPSQVNRSQLRPENICIVD
SNGSPIEIQSEMRPSREILMHLEVYKEKKDVRAIMYTHSLYATIFAVANKGIPPVVADAR
YYGGYIYVAPYEKAQTIELAKSVIEPLRKSDACLLERHGLLVVSDDVDKVLLKARYVEDV
AEIYYKALLLNKFKEPNRLDKDELK
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgttagaaaatttaaggattaaacttgttaagatagctaaggaagcagaaaaatatgga
ttgtgtaaagaaaaaacaggtagttttagtataaaagataaaacaacaggttatgttctt
ataacaccttcacaagtaaatagaagtcaactaagaccagaaaatatttgcattgtagat
tcaaatggaagtccaattgaaatacagagcgaaatgaggccaagccgtgaaattttaatg
catcttgaagtatataaagaaaaaaaagatgtaagagctataatgtacactcattcatta
tatgcaactatatttgcagtagctaataagggaattccaccagttgttgcagatgctaga
tattatggaggatacatttacgtagcaccttatgaaaaggctcaaactattgaattagct
aaaagtgttatagaaccacttcgtaagagcgatgcatgtttacttgagagacatggttta
cttgtagtaagtgatgatgtagataaagttttattaaaggccagatatgttgaagatgta
gctgaaatatattataaggcattattactaaataaatttaaggagccaaatagattagac
aaagacgaattaaaataa

DBGET integrated database retrieval system