KEGG   Clostridium saccharobutylicum: CLSA_c28100Help
Entry
CLSA_c28100       CDS       T02876                                 

Gene name
amyS
Definition
alpha-amylase AmyS (EC:3.2.1.1)
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
csb  Clostridium saccharobutylicum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CLSA_c28100 (amyS)
Enzymes [BR:csb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     CLSA_c28100 (amyS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3145209..3146879)
Genome map
AA seq 556 aa AA seqDB search
MILNFYNRTYNTKIDKNELKEHLNIDKVLKDEIKKSKKNIIEENNIHYRSYNEEFKNHLK
APDFLRNYNQLLENTEVNETMMQYFEWYYPSDGSLWKKVKQNVKELCNVGITALWLPPAC
KSYNGIYDVGYGIYDLFDLGEFNQKGTIRTKYGTKEEYISAIEEAHRNNIKIYGDVVFDH
KAGADNSEIIDARPVSENNRKMFIGTTRKIRAHTIFTFPGRMEKYSAYKWTSSDFNGVDF
DEISKQHGIFKFEGKEWEKYVDKENGNYDFLMFANLDMNNTYVVEELKRWGRWYINQTNV
DGFRLDAIKHIKFTFFKEWLKDMRKYSDKKLFAVGEYWTPDVNNLKDYMNACENCMSLFD
VPLHYNFYAASNSLGNFDMRKLTDNTFLKANPSQAVTFVDNHDTQPGQSLESWVQPWFKP
LAYTFILTRKDGYPCVFYGDYYGIPEKNFEGIKDKLDIILKIRKYNAYGIQHDYIDDNAI
IGWTREGDFKHKNSGLAALITVALGGVKKMYVGNQHAYEVWKDITGQIDDKVIIDESGQG
IFRVMDGSYSIWINEV
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgatattaaatttttataatagaacttataatacaaagatagataagaatgaattaaaa
gaacatttaaatatagataaagttctcaaagatgaaataaaaaaatcaaaaaaaaatata
attgaagagaataatatacattatagaagttataatgaagagtttaagaatcatttaaaa
gcaccagattttttaagaaattataatcaactattagaaaatactgaagttaatgagaca
atgatgcaatatttcgaatggtattacccaagtgatggttcattgtggaaaaaggtaaag
caaaatgttaaggaattatgtaacgttggaattacagcattatggttaccgcctgcatgt
aaatcatataatgggatttatgatgttggatatggaatatatgatttatttgatttagga
gaatttaatcaaaagggaaccattagaaccaagtatggaacaaaagaagaatatatatct
gccatagaggaggctcataggaataatataaaaatttatggagatgtagtatttgatcac
aaggcaggggcggataattctgaaattatagatgcaagacctgtatcagaaaataataga
aaaatgtttattggcaccacaagaaaaataagagcacatacaatttttacttttccaggt
agaatggaaaagtattctgcatataaatggacatcaagcgattttaatggagtagatttt
gatgagatttcaaagcaacatggtatttttaagtttgaaggaaaggaatgggaaaaatat
gttgataaggaaaatggaaattatgattttcttatgtttgccaatttagatatgaataat
acttatgttgttgaagaattaaaaagatggggaagatggtatataaatcaaactaatgtt
gatggctttagattggatgctataaaacatattaaatttactttctttaaagaatggctt
aaagatatgaggaagtatagtgataagaaactttttgcagtaggcgaatattggactcct
gatgttaataatcttaaagattatatgaatgcatgtgaaaattgcatgagtttatttgat
gtgccacttcattataatttttacgctgctagtaactcattaggaaattttgatatgaga
aagttaacagataatacatttctaaaagctaatccaagtcaagcggttacttttgttgat
aatcacgacacacagcctggtcaatcgctagaatcatgggttcaaccttggtttaagcct
ttggcatatacatttattttgactagaaaggacggctatccatgtgttttttatggagat
tattatggaataccagaaaagaactttgagggaataaaggacaaattagatattattcta
aagataagaaaatataatgcttatggtatacaacatgattatattgatgataatgctatt
ataggatggactagagaaggagattttaaacataaaaactcaggtcttgcagctctgatt
actgtagcacttggtggtgttaaaaaaatgtatgttggaaatcaacatgcatatgaagtg
tggaaggatattacaggacaaattgatgataaagtaatcatagatgaaagtggacaaggc
atatttagagtcatggatggttcatattctatatggattaatgaagtatga

  All links  
No link information was found.   
DBGET integrated database retrieval system