KEGG   Clostridium saccharobutylicum: CLSA_c41800Help
Entry
CLSA_c41800       CDS       T02876                                 

Gene name
yobN
Definition
putative L-amino-acid oxidase YobN (EC:1.4.3.2)
Orthology
K00274  
monoamine oxidase [EC:1.4.3.4]
Organism
csb  Clostridium saccharobutylicum
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:csb00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CLSA_c41800 (yobN)
   00330 Arginine and proline metabolism
    CLSA_c41800 (yobN)
   00340 Histidine metabolism
    CLSA_c41800 (yobN)
   00350 Tyrosine metabolism
    CLSA_c41800 (yobN)
   00360 Phenylalanine metabolism
    CLSA_c41800 (yobN)
   00380 Tryptophan metabolism
    CLSA_c41800 (yobN)
Enzymes [BR:csb01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     CLSA_c41800 (yobN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4650537..4652276)
Genome map
AA seq 579 aa AA seqDB search
MNSYKNTDSPYQIDNPSESERYTMLEYILKIQNRSDDLNNIIDLMSPPKDITNICKAGCA
KNIKVAVIGAGEAGLAAAFELRKIGCNIVLFEASQRIGGRVYTHYFDRNRKYYGELGPMS
IPISHETTWHYINLFKLETSPFVDYNYNSLFYVKDERAVNDASGISAKNNIYPKFNLSKI
EGKKSWRELHERICKKYLSSFSAELRKELIQVKPEYSKNIKEIDKLNYRNAYENVDLSQD
SISMLGYLDGKEQFFSLSLIEMLQKYYTADFEYNYRITDGMINLPQSLYEALCDKSEEGY
KDINKEQLGKVEIKMGFPVSGIYDSSSKDKVILKYMDCRDNKETSEEFDYVICAIPFSSL
RRIQIEPLFTNRKMQAISEMNYEIAHKIYLYLKNRFWEMGNASTKIVGGSSHTDLPLVSI
YYPSDHAKAVANKYGKWILKHGASYKEAGALLAGYSWGQDAVRLGNENPELLLDDVMRYV
ERVHGLSLHYLDDKLIDYKSLIWSDVQYIWTGGALSKPGDKTLFSYNVTVPEMEDKVFFA
GEHISQKHVSQQGALQSGMIAANEIAKRINDNAVNIKRS
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgaattcttataagaatacagattctccatatcaaatagataatcctagtgagtctgaa
agatatacgatgcttgaatatatactcaagatacagaatagatcagatgatttaaataat
ataattgatttaatgagtccgccaaaagatataactaatatttgtaaagctggatgcgca
aaaaatataaaagtagctgtaattggtgctggagaagctggcttagctgctgcttttgaa
cttagaaagataggctgtaacattgttttatttgaagcaagtcagcgaataggaggcagg
gtatatactcattattttgatagaaatagaaagtattatggcgagttaggaccaatgagt
ataccaatatctcatgaaactacctggcattatataaatctttttaaacttgagacaagt
cctttcgtggattataattataattctttattttatgttaaagatgagcgtgcggttaat
gatgctagtggtataagtgccaaaaataatatatatcctaaatttaatttaagtaaaatt
gaaggtaaaaaatcatggcgtgaacttcatgaaagaatatgtaaaaaatatttaagctct
ttttcagcagaactaagaaaggaattgattcaagttaaacctgaatattcaaagaatata
aaagaaatagataaattaaattatagaaatgcatatgagaatgtagatcttagtcaagat
tccatatcaatgcttggatatttagatggcaaagaacaattttttagtttaagtcttata
gaaatgcttcaaaagtactatacagcagattttgaatataactatcgtattaccgatgga
atgattaatttgcctcagtcattatatgaagcactttgtgataaaagcgaagagggttat
aaagatattaataaagaacaattagggaaagtagaaataaaaatgggtttccctgttagt
ggaatatatgattcttcttcaaaagataaagttattcttaaatacatggattgtagggat
aataaagaaacatccgaagagtttgactatgtaatatgtgcaataccattttcaagttta
aggagaattcaaatagaacctcttttcacaaatagaaaaatgcaggctataagtgaaatg
aattatgaaatagcacacaagatatacttatatcttaaaaatagattttgggaaatggga
aatgcatcaacaaagatagtaggaggaagttcgcatacagatcttcctctagtttcaatt
tactatccttcagatcatgcaaaagctgtagctaataaatatggcaagtggatattaaaa
catggagcaagctataaagaggctggtgcattattagcaggttatagctgggggcaggat
gcagtaaggcttggaaatgagaatccagaattgttacttgatgatgttatgagatatgta
gaaagagttcatggtttatctcttcattatcttgatgataaattaattgattataagtca
ttaatttggtctgatgtacaatatatatggactggaggggcattatcaaaaccgggagat
aaaacacttttctcatataatgtaacagttccagagatggaagataaagtgttttttgca
ggagagcatatatcacaaaagcatgtatctcagcaaggagctcttcaaagtggtatgatt
gctgcaaatgaaatagcaaaaaggataaatgataatgcggtaaatataaaaagaagttaa

DBGET integrated database retrieval system