KEGG   Clostridium saccharobutylicum: CLSA_c43820Help
Entry
CLSA_c43820       CDS       T02876                                 

Gene name
glgB
Definition
1,4-alpha-glucan branching enzyme GlgB 1 (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
csb  Clostridium saccharobutylicum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:csb00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4921765..4924185)
Genome map
AA seq 806 aa AA seqDB search
MQDKPNKSNNVNIEESIGVEDNTNKAIEQEKKKIAKKGTSTIAKAKSTRKSSKSQEKIEP
KDVITLDIDKTVDGTENEKDNKAVASKTKATRKTTSKSSTKTTKSVATKTTTRSRKNKST
TSSSKKSESSKDKTKVIAKDSLQVKTEQIKNKFDNVAKQVDKTDLTNFNTYLFHKGNNYE
SYNILGSHVKTENKHKGVQFATWAPNAMEVYVVGDFNEFEVRDEYKLEKITENGLWNGFF
TRAKQGDKYKYCIVGQDGQMGEYKADPYAICTELRPGNASIIYEPENYKWNDKSWVDKRN
KANVLEQPLNIYEMHLGSWKTNNEGGFLTYEEISEELPGYLKEMGYTHVEIMPLVEHPLD
ASWGYQGTGYYSPTSRYGKLEGLKILVDKLHEANIGVIMDWAPGHFCKDAHGLYKFDGSA
TYEYQEEWRAENKGWGTCNFDLGRCEVKSYLISNALYWFREFHVDGLRVDAVSSILYLDY
SRKQGEWVPNKYGGNGSLEAIEFLKELNAAVFAEYPTALMIAEESTSWPNVTKPPVHDGL
GFNLKWNMGWMNDTLEYIEIDPKYRKDNHRNITFAMMYNYAENYVLPLSHDEVVHGKKSL
VEKMWGDEWNKFAGLRTFIGYMMGHPGKKLLFMGNEFAQRIEWREYESLQWNLINELEIH
KQTQLFFKDLNHLYLNNKAFWELDHDYKGFNWIEADNSEQSVLIFARRSRNDDDTLIFII
NFTSTVYYDYQIGVPFLGTYEELFNTDDSKYGGSGQVMGTELVAEKEGFQNQPYSLKIKV
PPMATLILKIKEIENEKEFDELKIDE
NT seq 2421 nt NT seq  +upstreamnt  +downstreamnt
atgcaagataaacctaataaaagcaataacgtcaatatagaagaaagtataggagttgaa
gacaatacgaataaggcaatagaacaagaaaagaaaaaaattgctaaaaaaggtacttcg
actattgcaaaagcaaagtccacaagaaaatcaagtaaatcacaggaaaaaatagaaccc
aaagatgtaataactttagatatagataaaacagtggatggaacagagaatgaaaaagat
aataaagctgttgcatctaaaactaaagctacaaggaaaacaacttcaaaatcttcaacc
aaaacaactaaatcagttgcaactaaaacaaccactaggagtagaaaaaataaatcaact
actagtagttcaaaaaaatcagaatcaagtaaagataaaactaaagttatagcaaaggat
agtctacaagttaaaactgaacaaataaaaaataaatttgacaacgttgcgaaacaagtg
gataagacagatttgactaattttaacacatatttatttcataaaggaaataattatgaa
tcatataatatattaggatcccatgttaaaactgaaaataaacataaaggcgtgcaattt
gctacatgggcacctaatgctatggaagtatatgttgttggagactttaatgaatttgag
gtacgagatgaatataaacttgagaaaataacagagaatggattgtggaatggatttttt
actagagctaaacaaggagataaatataaatactgcatagttggacaagatggtcaaatg
ggtgaatataaagcagatccatatgcaatctgcactgaattaagacctggaaatgcttca
ataatatatgaaccggaaaattataagtggaatgataaatcatgggtagataaaagaaac
aaagcaaatgttcttgaacaacctttaaatatttatgaaatgcacttaggatcttggaaa
acaaataatgaaggtggatttcttacttatgaagaaattagtgaggaattacctggatat
ttaaaagaaatgggatatactcatgtagaaattatgccattagttgaacatccattagat
gcatcttggggatatcaaggaacaggatattattcaccaacaagtagatatggaaaactt
gaaggtcttaaaatattagtagataaattacatgaagctaatataggcgtaataatggat
tgggcaccaggacatttttgtaaagatgcacatggtttatataaatttgatggtagtgca
acttatgaatatcaagaagaatggagagctgaaaataaaggttggggaacttgcaatttt
gatttaggtagatgtgaagttaaaagttatttaatatcaaatgcgctatattggtttagg
gaatttcacgttgatggattaagagtggatgctgtatcaagtatcttatatttagattat
agtaggaaacaaggtgaatgggtaccaaataaatatggtggaaacggaagcctagaagct
atagaattcttaaaagaattaaatgcagctgtttttgcagagtatcctacagcacttatg
atcgctgaagagtcaacatcatggcctaatgtaactaagccacctgttcatgatggatta
ggttttaatctaaaatggaatatgggatggatgaatgatacgttagaatatattgaaata
gatcctaaatatagaaaagataatcatagaaatataacatttgcaatgatgtataattat
gctgaaaattatgtgttgcctctttcacatgatgaagtagttcatggaaaaaaatcatta
gtggaaaaaatgtggggagatgaatggaacaagtttgcagggcttcgtacattcatagga
tatatgatgggacatccaggcaaaaagttactatttatggggaatgaatttgcacaaaga
atagagtggagagaatacgaatcattgcaatggaatttaattaatgaattagaaattcat
aagcaaacacaattatttttcaaagatttaaatcatttgtatcttaataataaagcattt
tgggaacttgatcatgattataaaggatttaattggattgaggctgataacagtgaacaa
agtgtacttatatttgctagaagaagtagaaatgatgatgatacattaatttttataata
aactttacttctacagtttattatgattatcaaatcggagttccattcttaggaacttat
gaagaattgtttaatactgatgatagtaaatatggtggctcaggtcaagtaatgggaact
gagttagtggctgaaaaagagggattccaaaatcaaccatattctttaaagataaaagta
ccaccaatggctactttaatattaaaaataaaagagattgaaaatgaaaaagaatttgat
gaactaaaaattgatgaataa

DBGET integrated database retrieval system