KEGG   Caldicellulosiruptor saccharolyticus: Csac_0110Help
Entry
Csac_0110         CDS       T00506                                 

Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
csc  Caldicellulosiruptor saccharolyticus
Pathway
csc00790  Folate biosynthesis
csc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Csac_0110
Enzymes [BR:csc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Csac_0110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind Nairo_nucleo
Motif
Other DBs
NCBI-ProteinID: ABP65763
JGI: Csac_0110
UniProt: A4XFS8
Position
113409..114536
Genome map
AA seq 375 aa AA seqDB search
MRLISKDANIKKIMYQKGFDEGEILDFEKRASSVVLKFENIKDVSHFVKLLSDLGYYVVV
KDDIAFATTSKSNFERTKCYLAEEGFECSFEADFAISQRRLQAKDKVINLLKTNVMGIIN
VTPDSFYEGSRVDLAGVSQKALEMIQDGADVIDVGGESTRPFSEPVPEDEELKRVIPAIE
AIRTVSKDIPISVDTYKSSVARKAIEAGADIINDISGGTFDKDMFKVAAEYNVPIIIMHI
KGTPKDMQQNPYYEDVIEEILQFFEKRIDEALKAGVELENIILDPGIGFGKRLEDNLEII
RRCEEFKVLGRPILIGASRKSTIGTVLGGLPPQDRLEGTIAISTICALKRIEFVRVHDVK
ENKRAILMTEAIINS
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
ttgagacttatttcaaaagatgcaaatataaagaaaattatgtaccaaaaaggatttgat
gaaggggagattttagattttgaaaaaagagcaagtagtgtagttttaaaatttgaaaat
atcaaagatgtttcgcactttgtaaagcttctttcggaccttggttattatgtagttgta
aaagatgatattgcttttgctacaacttcaaagtctaattttgaaagaacaaagtgttat
cttgctgaggagggttttgagtgcagttttgaagctgattttgctatttcacaaagaagg
cttcaagcaaaggacaaggtcataaatcttcttaagacaaatgtgatgggtataataaat
gtcacgccagactctttttatgagggctcaagagttgacttggctggggtttcccaaaaa
gcacttgagatgattcaagacggggcagatgtgattgatgttggaggagagtcaacaagg
ccattttcagaaccagtgccagaagatgaggagctaaagagggttattcctgcaattgaa
gcaataagaactgttagcaaggacattccaatctccgttgacacttataaaagctctgtt
gcaagaaaggcaatagaggctggtgctgacataataaatgatattagcggtggcacattt
gacaaagacatgttcaaggtagcagcagagtataatgtccctattattatcatgcacata
aaaggcacgcccaaggatatgcagcaaaacccctattatgaagatgttatagaagagatt
ttgcagttttttgaaaaaaggattgatgaggcactcaaagcaggggttgagcttgagaac
atcatcttagacccagggatagggtttgggaaaaggcttgaggacaatttagaaataata
agaagatgtgaagagttcaaagttcttggaaggccaattttgattggtgcgtcaagaaaa
tctacaattggtactgtgttaggagggcttccacctcaagataggcttgaagggacaatt
gcaatttcgacaatttgtgcactaaagaggattgaatttgtaagagtgcacgatgtgaaa
gagaacaaaagagcaatcttgatgacagaagctattataaatagctaa

DBGET integrated database retrieval system