KEGG   Caldicellulosiruptor saccharolyticus: Csac_0112Help
Entry
Csac_0112         CDS       T00506                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
csc  Caldicellulosiruptor saccharolyticus
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Csac_0112
Enzymes [BR:csc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Csac_0112
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
114787..115257
Genome map
AA seq 156 aa AA seqDB search
MSQKITIFLGLGSNLGDRQKNIEMAIEYLKEKVEIEKVSKIIETEPYGYVEQPKFLNCCV
MGKTQLSPAELLDFVLSIEEKMGRKRLFKWGPRNIDIDILFYDSATIDQENLKIPHPELH
KREFVLLPLIEIAPDFVHPAFKKTVLELYRELKNSM
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
gtgtcacagaagataactatttttttaggacttgggagcaaccttggtgacaggcagaag
aatatagagatggcaatagagtatttaaaagaaaaggtagaaattgaaaaggtctcaaag
attattgagacagagccttacgggtatgtagagcagccaaagtttttaaactgctgtgta
atgggtaagacacagctttcacccgctgagcttttagattttgtgctgagtatagaagag
aagatgggccgaaaaaggctttttaaatggggtccgagaaacattgatatagacatttta
ttttatgactctgctacaatagaccaagagaatttgaaaattcctcatccggagttacac
aagcgagagtttgtactcctgccactgattgaaatagcaccagattttgtccacccagcg
tttaaaaagacagttcttgagctctacagagagcttaaaaattcaatgtga

DBGET integrated database retrieval system