KEGG   Caldicellulosiruptor saccharolyticus: Csac_0179Help
Entry
Csac_0179         CDS       T00506                                 

Definition
response regulator receiver modulated CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
csc  Caldicellulosiruptor saccharolyticus
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:csc00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Csac_0179
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Csac_0179
Enzymes [BR:csc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Csac_0179
Two-component system [BR:csc02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Csac_0179
Bacterial motility proteins [BR:csc02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Csac_0179
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
186574..187629
Genome map
AA seq 351 aa AA seqDB search
MIVDDSELMCEVIKGALRGLGEDIVVFIATNPLIAIRKAGLFNIDLALIDYEMPYMNGLL
LIGYLKEINPLTKIVMVSAYTEPGAQITLEALARGAIDYILKPSNKEEFEGFKKELLEKV
RWILTGREFSRKKSKIEKDRSKVLSYLEGLKAGTPNYLVDKLRESKVIAIGISTGGPPVL
EKIFTNLKKDFSIPILVVQHMPPAFTKALAERLCKLSQRQVKEAEDGEKIENGVIYIAKG
GVHLAVEKILGKYYLRLLENVEKVNSHKPSCDILFSSVAEWYGKNATGIIMTGMGCDGAN
GLLEMKNQGALTIAQSKESCVVFGMPRVAIEKGAAEAVLSTDEIIRLLNEV
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
ttgattgttgatgactctgaactgatgtgtgaagttataaagggagctttgaggggttta
ggagaagatatagttgtttttatagctacaaatcctcttatagctattagaaaggctggt
ttatttaacattgatttagcattaattgactatgaaatgccttatatgaatggtctttta
cttatcggctatttaaaggagataaatccattaacaaaaattgtaatggtttctgcttat
actgaacctggtgcccagattactcttgaagcacttgcaagaggtgcaattgattacata
ttaaaaccctcaaataaagaagaatttgaaggattcaaaaaagaactgttagaaaaagtt
cgctggatattaacaggaagagagtttagccgcaaaaaaagtaagatagagaaagacagg
tctaaggttttaagttatcttgagggtcttaaagctggtactcctaattatttagtggat
aagctaagagaaagtaaagtaatagcaattggaatttcaacaggaggtccccctgtttta
gaaaagatttttacaaatcttaagaaagatttttcaattccaatattggttgttcagcac
atgccaccagcatttacaaaagccttggctgaaagactttgcaaactttctcaaagacag
gtgaaagaagccgaagatggtgaaaagattgaaaatggtgtaatttatatagcaaaaggt
ggagtgcatcttgctgttgaaaagatcttaggaaagtattacttaagacttcttgaaaat
gttgaaaaggtaaatagccacaaaccatcttgtgatattttattcagttcggttgctgaa
tggtacgggaaaaatgcaacaggcataatcatgactggaatgggctgtgatggagcaaat
ggtcttttagaaatgaaaaatcagggtgccttgacaattgcgcaaagcaaagaatcatgc
gtagtttttggcatgccaagagttgctatagaaaaaggagcggctgaagcagtactaagt
acagatgagattataaggcttttaaatgaggtgtaa

DBGET integrated database retrieval system