KEGG   Caldicellulosiruptor saccharolyticus: Csac_0197Help
Entry
Csac_0197         CDS       T00506                                 

Definition
RecD/TraA family helicase (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
csc  Caldicellulosiruptor saccharolyticus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:csc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Csac_0197
Enzymes [BR:csc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Csac_0197
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
204635..206860
Genome map
AA seq 741 aa AA seqDB search
MLQDIKGMVSDIIYRNLENNYTVFEILCDDEVFTAVGIVPDIVIGEKVKVYGEFYVHPVY
GQQLKVSYLEKLLPETKDEIYLYLSSGVIKGIGQKTAKKIVEMFGDDTMRILQEEPEKLL
AVRGMTPEKVERIKNMFSFQKFLKDIMTIFSQYGLSQNHAMRLFKLYGFSALGLLYDNPY
FLLDVFPELDFKKVDRLAFDLGVSPDDMRRISAKIVNLLNMGSNNEGHICLPKEKLILFV
SKALEQDTEKVEEALDSLIKAKRVVIDTVDGLEMVFLYGFFECERYIAEKIASMLKEYDD
ILDIDERISEFEKKNSIVFSQNQKKAIKMALTQGVSVITGGPGTGKTTIIKCIIEIFEQE
GKKVFLCAPTGRAAKRMQQQCEKEAKTIHRLLEMTVTDSQVFFQKGPNNPLRCDVIIVDE
MSMVDSYIMYYLLSATKDTTRLVLVGDKDQLPSVGAGNILKDLIRSDVVPYVRLTEVYRQ
SEDSFIVLNAHRINNGEFPYLQKNSDFYFIQKNSPEEILKTIVELVTKKLPNYLSADPLT
DIQVLCPSKKGVVGMYNINRVLQQYLNPKDGSKKEVVYKENTFRVGDKVMQIKNNYSLEF
TIIEGEEKGKVSTGIFNGDIGVIKDIDRAGSAMEIVFDDDKLVFYDFSLLDDLELSYAMT
VHKSQGSEFRCIVMPVVETYPILMTRNLLYTAVTRAKELVVLVGKKSALEYMIANQKEAM
RYSALYDFLKRKLKDTQLQAL
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atgcttcaagacataaaaggcatggtaagcgacattatatatagaaacttagaaaacaac
tacacagtatttgagatactctgcgatgatgaggttttcacagcagttggaattgtacct
gacattgtaattggtgagaaagtaaaagtatatggtgaattttatgtccaccctgtctat
ggtcagcaactaaaagtgtcgtaccttgaaaagcttttgccggagacaaaggatgagatt
tacctctacctctcttcaggtgtcataaaaggcattgggcagaagactgcaaagaaaatt
gtggaaatgtttggcgacgatacaatgagaattttgcaggaagaacctgaaaagcttttg
gctgtacgcggaatgacacctgagaaggttgagagaataaagaatatgttttcattccag
aagtttttaaaagacatcatgacaatattttcccagtatggactttcacaaaaccatgca
atgagactttttaaattatatggtttttcagctttgggtctactttacgacaacccctat
tttttacttgacgtgtttccagagcttgactttaaaaaagtggacaggcttgcatttgac
ttgggagtttcacctgatgatatgagaagaatctcagcaaagattgtaaatcttttaaac
atgggtagcaataatgaagggcatatatgccttccaaaagaaaaactcattttgtttgtt
tcaaaggcgcttgaacaagatacagagaaggttgaagaagcacttgatagtcttataaaa
gcaaaaagggttgttattgatactgttgacggtcttgagatggtttttttatatggattt
tttgagtgtgaaaggtatatcgcggaaaagattgcctcaatgctaaaggaatatgatgac
attttagacatagatgaaagaatctctgagtttgaaaagaaaaacagcatagtattttct
cagaatcagaaaaaagctatcaaaatggccctaactcaaggtgtgagtgtgattactggg
gggcccggcacaggaaagactacgattataaaatgtataattgagatatttgagcaggaa
ggcaaaaaggttttcttgtgtgcaccaactggaagggcagcaaagaggatgcagcagcaa
tgtgaaaaagaggcaaagactattcacaggcttttggaaatgactgtaacagattctcaa
gtgttttttcaaaaaggtcccaataatcccttgagatgtgatgtcattatagttgatgag
atgagcatggtggacagttacattatgtactatcttctttctgcgacaaaagatacaaca
agacttgttttagttggcgataaagaccagctcccttctgttggtgcaggaaatatctta
aaagacctgatacgaagcgatgttgttccatatgtaaggcttactgaagtgtatagacaa
agtgaagacagctttatagttttaaacgcacacaggataaacaatggtgagtttccatac
cttcagaaaaacagtgatttttatttcattcaaaaaaattctccagaggaaatactaaaa
accattgttgaacttgtaacaaaaaagctgccaaactatttatcagcagacccactgaca
gacattcaggttttgtgtccatctaaaaaaggagttgtggggatgtacaatataaacagg
gtacttcagcagtatttaaatcccaaagatgggtctaaaaaggaggttgtctacaaagaa
aacactttcagagtcggcgacaaggtgatgcaaataaagaacaactactcacttgaattt
acaattatagaaggtgaagagaagggcaaggtctcaacagggatatttaacggcgatatt
ggggttataaaggacattgacagggcaggcagtgcaatggagattgtatttgacgatgac
aagcttgtattttacgacttttcgctcttggatgacttggagctttcttatgccatgact
gttcacaaatcccaagggtctgagtttaggtgcattgtaatgccagttgttgagacctac
ccgattttaatgaccagaaaccttctgtacacagcagttacgcgcgcaaaagagcttgtt
gtgctggtgggtaaaaaaagtgccttggagtacatgatagcaaaccaaaaagaggctatg
cgatattcagcactttacgactttttaaaaaggaagctaaaagatacgcaattgcaagct
ttataa

DBGET integrated database retrieval system