KEGG   Caldicellulosiruptor saccharolyticus: Csac_0197Help
Entry
Csac_0197         CDS       T00506                                 

Definition
(GenBank) helicase, RecD/TraA family
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
csc  Caldicellulosiruptor saccharolyticus
Pathway
csc03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:csc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Csac_0197
Enzymes [BR:csc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Csac_0197
DNA repair and recombination proteins [BR:csc03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Csac_0197
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 HHH_4 UvrD_C_2 Viral_helicase1 AAA_11 Helicase_RecD PIF1 HHH_5 AAA_24 ATPase_2 UvrD-helicase DEAD DUF2075 AAA_22 T2SSE UvrD_C DUF853 AAA_12 HHH_2 SRP54 AAA NTPase_1 PhoH ABC_tran ArgK Thymidylate_kin RsgA_GTPase AAA_25 AAA_29 DUF2666 ABC_ATPase AAA_28 AAA_5 Mg_chelatase AAA_16 TrwB_AAD_bind 5_3_exonuc HHH_3 cobW KTI12 ResIII
Motif
Other DBs
NCBI-ProteinID: ABP65845
JGI: Csac_0197
UniProt: A4XG10
Position
204635..206860
Genome map
AA seq 741 aa AA seqDB search
MLQDIKGMVSDIIYRNLENNYTVFEILCDDEVFTAVGIVPDIVIGEKVKVYGEFYVHPVY
GQQLKVSYLEKLLPETKDEIYLYLSSGVIKGIGQKTAKKIVEMFGDDTMRILQEEPEKLL
AVRGMTPEKVERIKNMFSFQKFLKDIMTIFSQYGLSQNHAMRLFKLYGFSALGLLYDNPY
FLLDVFPELDFKKVDRLAFDLGVSPDDMRRISAKIVNLLNMGSNNEGHICLPKEKLILFV
SKALEQDTEKVEEALDSLIKAKRVVIDTVDGLEMVFLYGFFECERYIAEKIASMLKEYDD
ILDIDERISEFEKKNSIVFSQNQKKAIKMALTQGVSVITGGPGTGKTTIIKCIIEIFEQE
GKKVFLCAPTGRAAKRMQQQCEKEAKTIHRLLEMTVTDSQVFFQKGPNNPLRCDVIIVDE
MSMVDSYIMYYLLSATKDTTRLVLVGDKDQLPSVGAGNILKDLIRSDVVPYVRLTEVYRQ
SEDSFIVLNAHRINNGEFPYLQKNSDFYFIQKNSPEEILKTIVELVTKKLPNYLSADPLT
DIQVLCPSKKGVVGMYNINRVLQQYLNPKDGSKKEVVYKENTFRVGDKVMQIKNNYSLEF
TIIEGEEKGKVSTGIFNGDIGVIKDIDRAGSAMEIVFDDDKLVFYDFSLLDDLELSYAMT
VHKSQGSEFRCIVMPVVETYPILMTRNLLYTAVTRAKELVVLVGKKSALEYMIANQKEAM
RYSALYDFLKRKLKDTQLQAL
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atgcttcaagacataaaaggcatggtaagcgacattatatatagaaacttagaaaacaac
tacacagtatttgagatactctgcgatgatgaggttttcacagcagttggaattgtacct
gacattgtaattggtgagaaagtaaaagtatatggtgaattttatgtccaccctgtctat
ggtcagcaactaaaagtgtcgtaccttgaaaagcttttgccggagacaaaggatgagatt
tacctctacctctcttcaggtgtcataaaaggcattgggcagaagactgcaaagaaaatt
gtggaaatgtttggcgacgatacaatgagaattttgcaggaagaacctgaaaagcttttg
gctgtacgcggaatgacacctgagaaggttgagagaataaagaatatgttttcattccag
aagtttttaaaagacatcatgacaatattttcccagtatggactttcacaaaaccatgca
atgagactttttaaattatatggtttttcagctttgggtctactttacgacaacccctat
tttttacttgacgtgtttccagagcttgactttaaaaaagtggacaggcttgcatttgac
ttgggagtttcacctgatgatatgagaagaatctcagcaaagattgtaaatcttttaaac
atgggtagcaataatgaagggcatatatgccttccaaaagaaaaactcattttgtttgtt
tcaaaggcgcttgaacaagatacagagaaggttgaagaagcacttgatagtcttataaaa
gcaaaaagggttgttattgatactgttgacggtcttgagatggtttttttatatggattt
tttgagtgtgaaaggtatatcgcggaaaagattgcctcaatgctaaaggaatatgatgac
attttagacatagatgaaagaatctctgagtttgaaaagaaaaacagcatagtattttct
cagaatcagaaaaaagctatcaaaatggccctaactcaaggtgtgagtgtgattactggg
gggcccggcacaggaaagactacgattataaaatgtataattgagatatttgagcaggaa
ggcaaaaaggttttcttgtgtgcaccaactggaagggcagcaaagaggatgcagcagcaa
tgtgaaaaagaggcaaagactattcacaggcttttggaaatgactgtaacagattctcaa
gtgttttttcaaaaaggtcccaataatcccttgagatgtgatgtcattatagttgatgag
atgagcatggtggacagttacattatgtactatcttctttctgcgacaaaagatacaaca
agacttgttttagttggcgataaagaccagctcccttctgttggtgcaggaaatatctta
aaagacctgatacgaagcgatgttgttccatatgtaaggcttactgaagtgtatagacaa
agtgaagacagctttatagttttaaacgcacacaggataaacaatggtgagtttccatac
cttcagaaaaacagtgatttttatttcattcaaaaaaattctccagaggaaatactaaaa
accattgttgaacttgtaacaaaaaagctgccaaactatttatcagcagacccactgaca
gacattcaggttttgtgtccatctaaaaaaggagttgtggggatgtacaatataaacagg
gtacttcagcagtatttaaatcccaaagatgggtctaaaaaggaggttgtctacaaagaa
aacactttcagagtcggcgacaaggtgatgcaaataaagaacaactactcacttgaattt
acaattatagaaggtgaagagaagggcaaggtctcaacagggatatttaacggcgatatt
ggggttataaaggacattgacagggcaggcagtgcaatggagattgtatttgacgatgac
aagcttgtattttacgacttttcgctcttggatgacttggagctttcttatgccatgact
gttcacaaatcccaagggtctgagtttaggtgcattgtaatgccagttgttgagacctac
ccgattttaatgaccagaaaccttctgtacacagcagttacgcgcgcaaaagagcttgtt
gtgctggtgggtaaaaaaagtgccttggagtacatgatagcaaaccaaaaagaggctatg
cgatattcagcactttacgactttttaaaaaggaagctaaaagatacgcaattgcaagct
ttataa

DBGET integrated database retrieval system