KEGG   Caldicellulosiruptor saccharolyticus: Csac_0395Help
Entry
Csac_0395         CDS       T00506                                 

Definition
alcohol dehydrogenase, zinc-binding domain-containing protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
csc  Caldicellulosiruptor saccharolyticus
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:csc00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Csac_0395
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Csac_0395
  Lipid metabolism
   00071 Fatty acid degradation
    Csac_0395
  Amino acid metabolism
   00350 Tyrosine metabolism
    Csac_0395
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Csac_0395
   00626 Naphthalene degradation
    Csac_0395
Enzymes [BR:csc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Csac_0395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
435586..436620
Genome map
AA seq 344 aa AA seqDB search
MDKMFGVVFPGDKKVEVREFPIPKPKDGEVLVKIKASAICRSDMSLYYGNPVVGGEIAKS
GSIIPGHEPAGEIVEVGKGVTNVKPGDRVAIYLAVSCGECLYCKSGYKMMCKQFKCIGFD
LHGGDAEYMVVPAENCMKIPDEMSYITAAVSTDAIGTLYHAQKRMGISGRDIVAIYGIGP
MGAAGILVAKGLGATVIAVDTIDKRLDWAKELGADYVINSQSTDAVQEILKITGDGADAA
IDCSGNPNAENNALNCVRPHGRVAFIGENSKTTIDPSNQFIRKQISLIGSWYFPIWEYEE
IANFIIRKKIPAEKLVTHTFKLKDAETAFGLFDNKETGKVVFVE
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggataagatgtttggggttgttttcccaggtgacaaaaaggtagaggtaagggagttt
cctattccaaaacctaaagatggcgaagtgcttgtaaaaattaaagcttcggcaatttgt
cgtagtgatatgagtctttactatgggaatccagtggtaggcggagaaattgctaaaagt
ggttcgataataccaggtcatgaaccagcaggtgaaattgttgaagtaggaaaaggtgta
actaatgtaaagccaggcgatagagtagctatttatttagcagtaagttgtggcgaatgt
ctctattgcaaaagtggatacaaaatgatgtgtaagcaatttaagtgtattgggtttgat
ttgcacggaggagatgccgaatatatggttgttcctgccgaaaattgtatgaagattcct
gatgaaatgagctatattactgccgcagtttccacagatgcaatcggtacactttatcat
gcacaaaaaagaatggggattagtggacgtgatatagttgctatatatggaataggtccc
atgggagctgctgggatactggttgcgaaggggttaggggcaactgtaatcgcagttgat
acaattgataagcgattagattgggctaaagagttaggagctgattatgtgataaatagt
cagtcaactgacgctgtacaagaaatactgaaaattactggagatggagcagatgctgca
attgattgctcaggtaatcctaatgcagagaataatgctctaaattgtgttagacctcat
gggagagttgcatttataggagagaactctaaaacaacaatagatccgagtaaccaattt
atacgaaaacaaataagtttgattggatcttggtattttccaatatgggaatatgaagag
atagctaactttataattagaaaaaaaatacctgcagaaaaattagttacccataccttc
aaacttaaggatgctgaaactgcatttggattgtttgacaataaagaaacaggtaaagtg
gtattcgtggaataa

DBGET integrated database retrieval system