KEGG   Caldicellulosiruptor saccharolyticus: Csac_0395Help
Entry
Csac_0395         CDS       T00506                                 

Definition
(GenBank) Alcohol dehydrogenase, zinc-binding domain protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
csc  Caldicellulosiruptor saccharolyticus
Pathway
csc00010  Glycolysis / Gluconeogenesis
csc00350  Tyrosine metabolism
csc00625  Chloroalkane and chloroalkene degradation
csc00626  Naphthalene degradation
csc01100  Metabolic pathways
csc01110  Biosynthesis of secondary metabolites
csc01120  Microbial metabolism in diverse environments
csc01130  Biosynthesis of antibiotics
csc01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:csc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Csac_0395
  Lipid metabolism
   00071 Fatty acid degradation
    Csac_0395
  Amino acid metabolism
   00350 Tyrosine metabolism
    Csac_0395
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Csac_0395
   00626 Naphthalene degradation
    Csac_0395
Enzymes [BR:csc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Csac_0395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C AlaDh_PNT_C 2-Hacid_dh_C ADH_N_2 NADH_4Fe-4S
Motif
Other DBs
NCBI-ProteinID: ABP66034
JGI: Csac_0395
UniProt: A4XGJ9
Position
435586..436620
Genome map
AA seq 344 aa AA seqDB search
MDKMFGVVFPGDKKVEVREFPIPKPKDGEVLVKIKASAICRSDMSLYYGNPVVGGEIAKS
GSIIPGHEPAGEIVEVGKGVTNVKPGDRVAIYLAVSCGECLYCKSGYKMMCKQFKCIGFD
LHGGDAEYMVVPAENCMKIPDEMSYITAAVSTDAIGTLYHAQKRMGISGRDIVAIYGIGP
MGAAGILVAKGLGATVIAVDTIDKRLDWAKELGADYVINSQSTDAVQEILKITGDGADAA
IDCSGNPNAENNALNCVRPHGRVAFIGENSKTTIDPSNQFIRKQISLIGSWYFPIWEYEE
IANFIIRKKIPAEKLVTHTFKLKDAETAFGLFDNKETGKVVFVE
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggataagatgtttggggttgttttcccaggtgacaaaaaggtagaggtaagggagttt
cctattccaaaacctaaagatggcgaagtgcttgtaaaaattaaagcttcggcaatttgt
cgtagtgatatgagtctttactatgggaatccagtggtaggcggagaaattgctaaaagt
ggttcgataataccaggtcatgaaccagcaggtgaaattgttgaagtaggaaaaggtgta
actaatgtaaagccaggcgatagagtagctatttatttagcagtaagttgtggcgaatgt
ctctattgcaaaagtggatacaaaatgatgtgtaagcaatttaagtgtattgggtttgat
ttgcacggaggagatgccgaatatatggttgttcctgccgaaaattgtatgaagattcct
gatgaaatgagctatattactgccgcagtttccacagatgcaatcggtacactttatcat
gcacaaaaaagaatggggattagtggacgtgatatagttgctatatatggaataggtccc
atgggagctgctgggatactggttgcgaaggggttaggggcaactgtaatcgcagttgat
acaattgataagcgattagattgggctaaagagttaggagctgattatgtgataaatagt
cagtcaactgacgctgtacaagaaatactgaaaattactggagatggagcagatgctgca
attgattgctcaggtaatcctaatgcagagaataatgctctaaattgtgttagacctcat
gggagagttgcatttataggagagaactctaaaacaacaatagatccgagtaaccaattt
atacgaaaacaaataagtttgattggatcttggtattttccaatatgggaatatgaagag
atagctaactttataattagaaaaaaaatacctgcagaaaaattagttacccataccttc
aaacttaaggatgctgaaactgcatttggattgtttgacaataaagaaacaggtaaagtg
gtattcgtggaataa

DBGET integrated database retrieval system