KEGG   Caldicellulosiruptor saccharolyticus: Csac_0678Help
Entry
Csac_0678         CDS       T00506                                 

Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
csc  Caldicellulosiruptor saccharolyticus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Csac_0678
Enzymes [BR:csc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Csac_0678
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
756453..758723
Genome map
AA seq 756 aa AA seqDB search
MKKECLRVFAVFMVFTFLLSLFPFVTFAQNTAYEKDKYPHLIGNSLVKKPSVAGRLQIIK
QNGRRILADQNGEPIQLRGMSTHGLQWFPQIINNNAFAALANDWGCNVIRLAMYIGEGGY
ATNPQVKDKVIEGIKLAIQNDMYVIVDWHVLNPGDPNAEIYKGAKDFFKEIAQKFPNDFH
IIYELCNEPNPTDPGVTNDEAGWKKVKAYAEPIIKMLRQMGNENIIIIGSPNWSQRPDFA
IKDPIADDKVMYSVHFYTGTHKVDGYVFENMKMAIEAGVPVFVTEWGTSEASGDGGPYLD
EADKWLEYLNANNISWVNWSLTNKNETSGAFVPYISGVSQATDLDPGSDQKWDISELSIS
GEYVRSRIKGIPYQPIERTLKISQDQVACAPIGQPILPSDFEDGTRQGWDWDGPSGVKGA
LTIEEANGSNALSWEVEYPEKKLQDGWASAPRLILRNINTTRGDCKYLCFDFYLKPKQAT
KGELAIFLAFAPPSLNYWAQAEDSFNIDLTNLSTLKKTPDDLYSFKISFDLDKIKEGKII
GPDTHLRDIIIVVADVNSDFKGRMYLDNVRFTNMLFEDVTPQTTGYEAISKLYSKKIVNG
ISTNLFGPEKAVTRAEVAAMAVRLLDLQEESYNGEFVDVSKNSWYANEVSTAYKAGIILG
DGKYIKPEKAVTREEMAVFAMRIYRILTDEKAEATEEIAISDKNSISSWARQDVNAAISL
GLMDVFTDGSFGPKVKVTRAEATQIIYKILELTGKM
NT seq 2271 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaagaatgtcttagagtttttgcagtctttatggtttttacttttttactatct
ctttttccctttgttacatttgctcaaaatactgcgtatgaaaaggataagtatccacac
ctgattggcaacagcttggtaaaaaaaccttctgtggctggaagactgcaaattatcaaa
caaaatggaagaaggattttagccgaccaaaatggagagcctattcagcttcgtggtatg
agcacacacggtctgcaatggtttccacagataattaacaacaatgcgtttgctgcactt
gcaaatgactggggttgcaatgtaattcgcttggcaatgtatataggagaaggtggatat
gctacaaatcctcaagtaaaagacaaggtcattgaaggtattaaattggcaattcaaaac
gacatgtatgtaatcgtagattggcatgttctcaatcccggcgaccccaatgcagaaatt
tataaaggggcaaaagactttttcaaggagatagcccaaaaatttccaaacgattttcat
ataatttatgagttgtgtaatgagccaaacccaacagacccaggtgtaacaaatgatgaa
gcagggtggaaaaaggtaaaagcttatgctgaaccaattataaagatgcttcgtcagatg
ggaaatgaaaacattataattataggttcgcctaactggagccaaagaccagattttgcg
ataaaagacccaattgcagatgacaaggtcatgtattctgttcatttctatacaggtaca
cacaaggtagatggatatgtgtttgaaaatatgaagatggcaattgaagcaggcgttcca
gtatttgtaacagaatgggggacaagtgaggcaagcggtgatggtggaccatatcttgat
gaggctgacaaatggcttgagtacctcaacgcaaacaatataagctgggtaaactggtcc
ttgacaaataaaaatgagacttctggtgcttttgtaccctacattagcggtgtgtctcaa
gcaacagatttggaccctggcagcgaccagaaatgggatatttcagaacttagcatctct
ggtgaatatgtacgatcaagaataaagggtattccatatcagcctattgagagaacattg
aaaatttctcaagatcaagtcgcgtgtgccccaattggtcaacctattttgccatctgat
tttgaagatggtacacggcaaggttgggactgggatggaccatctggtgttaaaggtgct
ttaacaatagaagaggcaaatggttcaaatgcactttcatgggaggttgagtaccctgaa
aaaaagcttcaagatggttgggcttctgctccaaggctaattttgaggaatataaataca
acaagaggtgattgtaagtatctctgctttgacttttacctaaaaccaaaacaggcaaca
aaaggtgagcttgcaatcttcctggcgtttgcaccaccttctcttaactattgggcacag
gcagaggatagctttaatatagatttgaccaatttatctacactgaagaaaacaccagat
gacctttattctttcaaaatttcttttgatttagataagataaaagaggggaagattatt
ggacctgatacccatctgcgagacataatcatagttgttgcagatgtaaacagtgatttt
aaaggtagaatgtacttagacaatgtaagatttacaaatatgctttttgaagatgttacc
cctcagacaactgggtatgaggctatttcaaagctttattctaagaaaatagtcaatgga
atttctacaaatttatttggccctgaaaaggcagtcacaagagctgaggttgctgctatg
gcagtcagactcttagatttgcaagaggaaagctacaacggagagtttgtagatgtaagc
aaaaatagctggtatgcaaatgaagtatctacggcatataaggcaggcataattttggga
gatggcaaatatataaaaccagagaaggcagtgacacgggaagaaatggcagtgtttgca
atgagaatttacaggattttgacagatgaaaaagctgaagctactgaagagattgcaata
tcagacaaaaactcaatcagtagctgggcaagacaagatgtaaatgctgctatttcgctt
ggactcatggatgtatttacagatggaagttttggaccaaaagtaaaggttacacgtgca
gaggctacacaaataatctacaaaattttagaacttacaggaaagatgtaa

DBGET integrated database retrieval system