KEGG   Caldicellulosiruptor saccharolyticus: Csac_0706Help
Entry
Csac_0706         CDS       T00506                                 

Definition
glutamyl-tRNA synthetase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
csc  Caldicellulosiruptor saccharolyticus
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:csc00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    Csac_0706
Enzymes [BR:csc01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     Csac_0706
Amino acid related enzymes [BR:csc01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   Csac_0706
Transfer RNA biogenesis [BR:csc03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Csac_0706
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
795940..797397
Genome map
AA seq 485 aa AA seqDB search
MEVRTRFAPSPTGHLHIGGARTALFNYLFAKRYGGKFILRIEDTDLERSSIESEKVIIES
LRWLGIEWDEGVEVGGPYGPYRSTERVDIYKKYVDVLFEKGYAYYCYCTEEELEAQRQEL
LSKGQMPRYLGKCRNLTEDQKRRFEQEGRKPTVRFKVPEGVKIVVHDLVRGDVEFLSDDI
GDFVIVKSDGIPTYNFAVVIDDHLMKISHVIRGEEHLSNTPRQILIYNALGFELPQFAHV
SLILGKDRTKMSKRHGSTWVEQYRDQGYLKEGLINFLALLGWSPPEDREIFDMEYLIENF
SLERVSKNPAIFDIDKLNYINSQHIKLKSLDELTQMCIPYFVEAGYIKEDEAKSKFEWLK
KIVKSVYEGLDYLSQIKDRVDIFFNNEVKIEEDEAKEVLKWDHVKDLINVFENKIRQMNE
LTPEAIKLLFKEIQKETGYKGKNLFMPIRVALTGKTHGPELVEIIEIVGKENILKRLEFF
KTWYN
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
gtggaagtaagaacaagatttgcaccaagcccaacagggcatcttcatatcggtggcgca
aggacagctctttttaactatctttttgccaaaagatatggtggaaagtttatattaagg
atagaagatacagatttagaaagatcatctattgagtctgaaaaggttattatcgagagc
ttaagatggcttgggattgaatgggacgaaggagttgaggtgggaggtccatatggacca
tatcgctcaacagaaagagtagatatttacaaaaagtatgtagatgtgctttttgaaaaa
ggctacgcctactattgttattgcacagaagaagagcttgaagctcaaagacaggagctt
ttatcaaaagggcagatgccaagatatcttggtaagtgcaggaatttaacagaggatcaa
aaaagaaggtttgagcaggaggggagaaaaccaacagtcaggttcaaagtaccagagggt
gttaagatagttgtccatgaccttgtgcgcggagatgttgagtttttaagcgatgatatt
ggcgactttgttattgtcaagtctgatggaattcccacatacaactttgcagttgtcata
gatgaccacttgatgaagatttcgcatgttataagaggtgaagaacatctttcaaacact
ccgcgacagattctaatttacaatgcgcttggatttgaacttccgcagtttgctcatgtt
tcgcttatacttggaaaagacagaacaaagatgtcaaagcgccacggctctacttgggtt
gagcagtatagagatcaagggtatttaaaagaggggctcataaacttcttggctctgctt
ggctggtcaccaccagaggatagagaaatatttgacatggaatatctaattgagaatttc
tcattagaaagagtttccaaaaatcctgcaatatttgacattgataagctaaattatata
aactctcagcacattaaactaaaatcattggatgaacttacccagatgtgcataccgtac
tttgttgaagcaggatatattaaagaagatgaggcaaagtccaaatttgaatggctcaag
aagatagtaaaatctgtgtatgagggactggattatttatctcagatcaaagacagggtt
gatatcttctttaacaatgaagtcaagatagaagaagatgaggcaaaagaggtcttaaaa
tgggatcatgtgaaggatttaattaatgtgtttgaaaataagataaggcagatgaatgaa
ttaactcctgaagctattaagctacttttcaaagagatacagaaggagacaggttacaag
ggcaaaaacctgtttatgccaataagagttgcgttgactggtaaaacccatggccctgag
cttgttgagataatagagattgtaggtaaagaaaacatactaaaacggttggaattcttt
aaaacgtggtataattag

DBGET integrated database retrieval system