KEGG   Caldicellulosiruptor saccharolyticus: Csac_0778Help
Entry
Csac_0778         CDS       T00506                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
csc  Caldicellulosiruptor saccharolyticus
Pathway
csc00010  Glycolysis / Gluconeogenesis
csc00052  Galactose metabolism
csc00500  Starch and sucrose metabolism
csc00520  Amino sugar and nucleotide sugar metabolism
csc00521  Streptomycin biosynthesis
csc01100  Metabolic pathways
csc01110  Biosynthesis of secondary metabolites
csc01120  Microbial metabolism in diverse environments
csc01130  Biosynthesis of antibiotics
csc01200  Carbon metabolism
Module
csc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:csc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Csac_0778
   00052 Galactose metabolism
    Csac_0778
   00500 Starch and sucrose metabolism
    Csac_0778
   00520 Amino sugar and nucleotide sugar metabolism
    Csac_0778
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Csac_0778
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Csac_0778
Enzymes [BR:csc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Csac_0778
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FGGY_N Peptidase_M22 DEDD_Tnp_IS110 Hydant_A_N
Motif
Other DBs
NCBI-ProteinID: ABP66397
JGI: Csac_0778
UniProt: A4XHL2
Position
875653..876603
Genome map
AA seq 316 aa AA seqDB search
MYYIGIDLGGTNIAAGIVDEEGKIIKKGTVPTGAHRHYSEILKDMADLSLNLVKECGLSL
DDIHSVGIGSPGTPDNEKGMILYSNNIVFLNVPMREEIQKYIPKPVNIENDANCAAYGEY
IAGGAKGTRISVTITLGTGIGGGVIIDGKIYTGAHHAGAELGHMVICVDGEQCTCGRRGC
WEAYASATALIRMTREAAARDINGTIMKLVGGDISKIDAKTAFDAKRMGDSTGAAIVDRY
VKYLAEGLVNVCNIFEPEVICVGGGVSKEGEYLLGPVREYVYEKFYCKQITPPKIIPAVL
GNDAGIIGAALLAKQI
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
gtgtattacataggaattgaccttgggggaacaaacattgcagcaggaattgttgatgaa
gaagggaaaatcataaaaaaagggactgttccgacaggtgcgcacaggcactactcagaa
atattaaaagacatggcagatctgagtttaaatcttgtaaaagagtgtgggctttctttg
gatgacattcactcagttggtattggaagccccggcacacctgacaatgaaaagggaatg
attctctatagcaacaacattgtttttttgaatgttcctatgagagaagagattcaaaaa
tacattccaaagcctgttaacatagaaaacgatgcaaactgtgcggcatatggtgagtat
atagcaggtggtgcaaaaggcacaaggatttctgttacaatcacattgggaactggcatt
ggcgggggagttataatcgatggaaaaatatacactggggcacatcatgcaggtgcagag
cttgggcatatggttatttgtgttgatggtgaacagtgcacatgcggtagaagagggtgc
tgggaagcgtacgcatctgcaacagctcttattcgaatgacaagagaggctgctgcaagg
gatataaacggcactatcatgaaacttgtaggtggcgatatttctaagattgatgcaaaa
acagcttttgatgcaaagcgaatgggagatagcactggtgcagcaattgttgataggtat
gtaaaatatttagcagaagggcttgtaaatgtttgcaatatatttgaaccagaggtaatt
tgcgttggcggaggagttagcaaagaaggtgaatacctgcttggaccggtaagagaatat
gtttacgaaaaattctattgcaaacaaataacacctcctaaaataattccagctgtctta
ggaaatgatgcaggtataattggtgctgcgcttttggcaaagcagatttaa

DBGET integrated database retrieval system