KEGG   Caldicellulosiruptor saccharolyticus: Csac_0778Help
Entry
Csac_0778         CDS       T00506                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
csc  Caldicellulosiruptor saccharolyticus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:csc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Csac_0778
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Csac_0778
   00052 Galactose metabolism
    Csac_0778
   00500 Starch and sucrose metabolism
    Csac_0778
   00520 Amino sugar and nucleotide sugar metabolism
    Csac_0778
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Csac_0778
   00524 Butirosin and neomycin biosynthesis
    Csac_0778
Enzymes [BR:csc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Csac_0778
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
875653..876603
Genome map
AA seq 316 aa AA seqDB search
MYYIGIDLGGTNIAAGIVDEEGKIIKKGTVPTGAHRHYSEILKDMADLSLNLVKECGLSL
DDIHSVGIGSPGTPDNEKGMILYSNNIVFLNVPMREEIQKYIPKPVNIENDANCAAYGEY
IAGGAKGTRISVTITLGTGIGGGVIIDGKIYTGAHHAGAELGHMVICVDGEQCTCGRRGC
WEAYASATALIRMTREAAARDINGTIMKLVGGDISKIDAKTAFDAKRMGDSTGAAIVDRY
VKYLAEGLVNVCNIFEPEVICVGGGVSKEGEYLLGPVREYVYEKFYCKQITPPKIIPAVL
GNDAGIIGAALLAKQI
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
gtgtattacataggaattgaccttgggggaacaaacattgcagcaggaattgttgatgaa
gaagggaaaatcataaaaaaagggactgttccgacaggtgcgcacaggcactactcagaa
atattaaaagacatggcagatctgagtttaaatcttgtaaaagagtgtgggctttctttg
gatgacattcactcagttggtattggaagccccggcacacctgacaatgaaaagggaatg
attctctatagcaacaacattgtttttttgaatgttcctatgagagaagagattcaaaaa
tacattccaaagcctgttaacatagaaaacgatgcaaactgtgcggcatatggtgagtat
atagcaggtggtgcaaaaggcacaaggatttctgttacaatcacattgggaactggcatt
ggcgggggagttataatcgatggaaaaatatacactggggcacatcatgcaggtgcagag
cttgggcatatggttatttgtgttgatggtgaacagtgcacatgcggtagaagagggtgc
tgggaagcgtacgcatctgcaacagctcttattcgaatgacaagagaggctgctgcaagg
gatataaacggcactatcatgaaacttgtaggtggcgatatttctaagattgatgcaaaa
acagcttttgatgcaaagcgaatgggagatagcactggtgcagcaattgttgataggtat
gtaaaatatttagcagaagggcttgtaaatgtttgcaatatatttgaaccagaggtaatt
tgcgttggcggaggagttagcaaagaaggtgaatacctgcttggaccggtaagagaatat
gtttacgaaaaattctattgcaaacaaataacacctcctaaaataattccagctgtctta
ggaaatgatgcaggtataattggtgctgcgcttttggcaaagcagatttaa

DBGET integrated database retrieval system