KEGG   Caldicellulosiruptor saccharolyticus: Csac_0872Help
Entry
Csac_0872         CDS       T00506                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
csc  Caldicellulosiruptor saccharolyticus
Pathway
csc00010  Glycolysis / Gluconeogenesis
csc00020  Citrate cycle (TCA cycle)
csc00620  Pyruvate metabolism
csc01100  Metabolic pathways
csc01110  Biosynthesis of secondary metabolites
csc01120  Microbial metabolism in diverse environments
csc01130  Biosynthesis of antibiotics
csc01200  Carbon metabolism
Module
csc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:csc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Csac_0872
   00020 Citrate cycle (TCA cycle)
    Csac_0872
   00620 Pyruvate metabolism
    Csac_0872
Enzymes [BR:csc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Csac_0872
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl CAT Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: ABP66488
JGI: Csac_0872
UniProt: A4XHV3
Position
980993..982375
Genome map
AA seq 460 aa AA seqDB search
MATPVIMPKQGQTVESCIITKWHKKKGEKVEVGDLLFSYETDKASFDEEAKVSGILLDIF
FEEGEEVPVLTNVAVIGQENESADIFNPKKGTDATISAESPGIVNEVKKGETVSQDRIEP
KQVLQSSDKIRISPRAKKLAEKLNVDFRFATPSGPEGRIIERDILELFNSGYVFTSAAKT
EAKEIGNLKDLEPSGIGGRITISDIEKAKESFKIQKSDIEISAQIIKDETEYEEAPLSNI
RKTIAKAMYLSLTTTAQLTLHTSFDASNILEFRKRVKENREKLGLEDITINDIILFAVSR
VLPKHKALNAHFLDDKMRYFKNVHLGFAVDTERGLMVPTIFNSNKKSLNQISKEAKELIQ
LCRKGTINPDLLKGATFTVTNLGSFGIEGFTPVLNPPQTGILGVNTIVMRAKEQNGQITY
YPAIGLSLTFDHRALDGADAARFLQDLKKWLENFELLLAL
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atggcaacacctgtaattatgccaaaacaagggcaaactgtagaaagttgtattataaca
aaatggcacaagaaaaagggagaaaaggtagaagtaggtgaccttttgttctcatatgag
acggacaaagcaagttttgatgaagaggcaaaggtaagtggaatacttttggacattttt
tttgaagaaggtgaagaggtacctgttttgacaaatgtagctgttattggtcaggaaaat
gagtccgcagatatattcaatcctaaaaaaggaactgacgctacgatatctgctgaaagc
cctgggatagtaaacgaggtcaaaaagggagaaaccgtctctcaagacaggatagaacca
aaacaagttttgcagtcttctgataaaataaggatttcaccaagagctaagaaattggcg
gaaaagctaaatgttgactttagatttgcaactccctcgggacctgaaggaagaataatt
gaaagggatattttggagctttttaactctggatatgtatttacctctgcagctaagact
gaggcaaaagagattggaaatttaaaagatttagagccaagcggaattggtgggagaatt
acaatatctgacattgaaaaagcaaaagagagctttaagatacaaaaaagtgatattgag
atttcagcgcaaattattaaagatgaaacagaatatgaagaagctcctctttctaatatc
agaaagactattgcaaaagcgatgtacctttcacttacaacaacggcccagctcactttg
cacacctcctttgatgcaagcaatattcttgagtttaggaaaagggttaaggaaaatagg
gaaaagcttggtcttgaagatattactataaacgacatcatactttttgcagtctcaaga
gtacttccaaagcataaagcattaaatgcacattttctggacgacaagatgagatatttc
aaaaatgttcatttaggatttgctgtggacactgaaagaggtctgatggttccaacaatc
tttaatagtaataaaaaatctctaaatcagatatccaaggaagcaaaagaacttattcag
ctttgcagaaagggtaccataaatccagaccttttaaaaggtgcaacatttactgtcaca
aacttaggaagctttggaatagaaggttttaccccagtactaaatccacctcagacggga
atccttggtgttaatacaatagtgatgcgtgcaaaagaacaaaatggacagattacttac
tatcctgcgataggactttctttgacatttgaccacagggcacttgacggtgctgatgca
gcaaggtttttacaggatttaaaaaagtggcttgagaattttgagcttttgttggcactt
tag

DBGET integrated database retrieval system