KEGG   Caldicellulosiruptor saccharolyticus: Csac_0920Help
Entry
Csac_0920         CDS       T00506                                 

Definition
UDP-N-acetylmuramyl-tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
csc  Caldicellulosiruptor saccharolyticus
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:csc00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:csc00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1036617..1038083
Genome map
AA seq 488 aa AA seqDB search
MKINKLIEGLEMIETNIKNFDEDIKDVAYSSKNVEDGFAFICIKGFKTDGHEYIDEAIER
GAKLIIVDEFYDTSKLKDKVLFIKTSNTRKALSVISANFFEHPSKNFLLIGVTGTNGKTS
TTFMIKSILEQSGHKVGLIGTVKNMIGQKEIEAKHTTPESYDLQKLFFEMKKENVDSVVM
EVSSHSLELHRVDCCDFDVGVFTNLTQDHLDFHGTMENYFAAKLKLFEMSKKRVVNVDDE
WGRKIIRIYPDSVTYGINSKADVCAMSVKLYVNKNQFELRQLDNDNKEQVTLNIPGIFSV
YNALAAASCAYALGIDLKTIKAGLESVKAIPGRFEIVESNDKFTIVIDYAHTPDGLLNLM
KTVDEVAKGRKVLLFGCGGDRDRTKRPIMGEIAGKMADFVIVTSDNPRTEDPIKIIEDIL
VGLQKTNAEYVVIPDRFEAIKYAIKNAKENDFIVLAGKGHETYQILKDRTIHFDEREVVR
SILEELKK
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaataaacaagctaatagaaggtttggagatgattgaaacaaatataaaaaatttt
gatgaagatataaaagatgttgcttatagttcaaaaaatgtagaagatggctttgcattt
atatgtataaaagggtttaagacagatgggcatgagtatatagatgaagcaatagaaaga
ggtgcaaagcttataattgtcgatgaattttacgacacctcaaagttgaaagataaggtc
ctctttataaaaacctcaaatacaaggaaagctctttcggttatttctgctaactttttt
gaacatccatcaaaaaactttttactcattggtgttacagggacaaacggcaagacttcg
accacctttatgataaagtcaatccttgaacaaagtggtcataaggttggccttattgga
acagttaagaatatgattggtcaaaaggagatagaagcaaagcacacaacacctgaatcc
tacgatttgcagaaactattctttgagatgaaaaaagaaaatgtagacagcgttgtaatg
gaagtgtcatcacattcgcttgaactgcatcgggttgattgttgtgactttgatgtggga
gtatttaccaatctcacccaagaccatcttgattttcatgggacaatggagaattatttt
gctgctaagttaaaactttttgagatgagtaaaaaaagagttgtcaatgtagacgatgaa
tggggaagaaaaattatcaggatttatccggattctgtcacatatggtataaattcaaaa
gcagatgtttgtgcaatgagtgtgaaactgtatgtgaataaaaaccaatttgagcttagg
caattggataatgataataaagagcaagtaacgcttaatattcccggcatcttttctgta
tacaatgcattggcagctgcaagctgtgcctatgcgcttggaatagacttaaaaacaata
aaggcaggtcttgaatctgttaaggcaatacctggtaggtttgagatagttgagtcaaat
gacaaattcacaattgtaattgactatgcacacacgccagatgggcttttaaatcttatg
aagacagtggatgaggttgcaaaaggaagaaaggtacttctttttggctgtggaggagac
agagacaggacaaaaaggccgattatgggtgagatagctgggaaaatggctgattttgtg
attgtcacatctgacaatccgcgaactgaagatccgattaaaataatagaggatattctt
gtggggttgcaaaagacaaacgctgagtatgtagttattccagacagatttgaagcaatc
aaatatgctataaaaaatgctaaagagaatgactttattgtccttgctggcaaaggtcat
gagacttaccagatactaaaagataggactattcattttgatgagagagaagttgtgaga
agtatcttggaggaactaaaaaaatga

DBGET integrated database retrieval system