KEGG   Caldicellulosiruptor saccharolyticus: Csac_1018Help
Entry
Csac_1018         CDS       T00506                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
csc  Caldicellulosiruptor saccharolyticus
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:csc00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1145558..1147588
Genome map
AA seq 676 aa AA seqDB search
MAKIKLKKFLYGGDYNPDQWSEDVWEQDIEFMKYYNVNAVSMPIFSWAQLQPSEDKFTFE
WLDRIIDKLYSNGIHVILATPTASQPAWLSKKYPDVLPVDIHGRKRKHGARQNYCPNSPN
FKNAARRIVEQMAKRYKDHPAIIMWHISNEYGPYCYCENCAKAFREWLKERYKTLDELNK
RWNTAFWGHTFYDWDEIEVPSYLNEEYEYMPGRQKSSFQGLSLDYKRFMSDSLLNLYKME
VEIIKKYMPDVPVTTNLMGPFKPLDYHKWAQYMDVVSWDNYPSIKDSPHSIAFKHDLMRG
LKRDQSFILMEQTPSQTNWQWYNSAKRPGMIRLLSYHAIAHGADSVLYFQWRQSVGSCEK
FHSAMVPHAGHLNTRVSKELKQIGDELLRLDEILESVNKSDVALLFDWENWWALEESMGF
RNDISYLEHIDSYYKALYKLKTNVDVVDPTEDLSRYKLVVAPLLYLLDSNTAKNIEEYVK
NGGIFITTFLSGLVDENDRVILGGYPGWFRKLLGIWIEEIDALFPDMKNAIILEKPLGTL
DGRYECDFICDVIHSEGAKVLAYYEQDYYKGMPAILENTYGSGKSVYIGTRPEQKVIEGL
IKYYADMAGVKPILPVPEGVEVTKRTKDGKEYIFLLNFNNYDVCIELPQEFYELITQKLF
GGRVVLRAKEVMILRK
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaatcaaactgaaaaaattcctttatggcggagattataatcctgaccagtgg
tcagaagatgtttgggaacaagatattgagtttatgaagtattacaatgtaaatgcagtg
tcaatgccaatattctcatgggctcagcttcagccaagtgaggacaagtttacgtttgag
tggcttgacagaataattgataagctctattcaaatggtattcatgtcatcttagcaaca
ccaacagcatctcaacctgcgtggctgtcaaaaaagtatcctgacgtattgcctgttgat
attcatggaagaaagagaaaacatggggcaaggcagaattactgccccaacagtccaaac
ttcaaaaatgcagcaagaagaattgttgaacagatggcaaaaagatacaaagaccatccg
gcgattataatgtggcatatcagcaacgaatatggtccttactgctactgtgaaaactgc
gctaaagcctttagagagtggctaaaagaaagatataaaacattggatgagcttaacaag
agatggaacacagctttctggggacatacattctatgattgggatgagatagaagttcca
tcgtatctgaacgaagaatatgaatatatgccaggcagacaaaaaagctcattccaggga
ctttcgcttgattacaaaaggtttatgtcagacagccttctaaatctttataagatggaa
gttgagattatcaaaaaatacatgccagatgtgcctgttacaacaaaccttatgggtcca
tttaaaccactcgattaccataaatgggcacagtatatggatgtagtttcgtgggacaat
tatccttctatcaaagactctccacattctatagctttcaagcatgaccttatgcgagga
cttaaaagggaccagtcatttatattaatggaacagacaccaagccagacaaattggcag
tggtataattcagcaaaacgccctggaatgataagacttttgagctaccatgcaatagct
catggtgcggactctgttttgtatttccagtggagacagtcggttgggtcgtgtgaaaaa
ttccactctgcaatggtaccacatgctgggcacttgaatacaagggttagcaaagagcta
aaacaaattggcgatgagcttttgcgcttagatgagattttagaatcagtaaacaaaagc
gatgtagcacttttgtttgactgggaaaactggtgggcacttgaagagagtatgggattt
agaaatgacatttcgtatttagagcacattgattcgtattacaaggctttgtataaactc
aaaacaaacgtagatgttgttgacccaaccgaagatttatcaaggtataaacttgttgtt
gcaccacttttgtatttgctcgatagcaatactgcaaagaatatagaagagtacgtgaaa
aatggaggaatatttattaccaccttcctatcaggtcttgttgatgagaacgacagggta
attcttggaggatatcctggctggttcagaaaacttttgggaatctggattgaggagatt
gatgcgctctttccagatatgaaaaacgcaatcattcttgagaagccacttggaacactt
gatggcaggtatgagtgcgactttatatgtgatgtcattcactcagaaggagcaaaagtg
cttgcttattatgagcaggactattataaagggatgccagctattttggaaaatacatat
ggcagtggcaagtcagtgtatataggtacaagaccagagcaaaaggttatagaaggactt
atcaagtactatgctgatatggctggtgtaaaaccaattttgcctgtaccagaaggtgtt
gaggttacaaaacgaacaaaggatggaaaagagtatattttccttttaaatttcaataat
tacgatgtatgtattgagttgccacaagaattctatgaactgataacgcaaaagctattt
ggtggcagagtagttctgagagcaaaagaagttatgatattaagaaaataa

DBGET integrated database retrieval system