KEGG   Caldicellulosiruptor saccharolyticus: Csac_1018Help
Entry
Csac_1018         CDS       T00506                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
csc  Caldicellulosiruptor saccharolyticus
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:csc00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Csac_1018
Enzymes [BR:csc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Csac_1018
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1145558..1147588
Genome map
AA seq 676 aa AA seqDB search
MAKIKLKKFLYGGDYNPDQWSEDVWEQDIEFMKYYNVNAVSMPIFSWAQLQPSEDKFTFE
WLDRIIDKLYSNGIHVILATPTASQPAWLSKKYPDVLPVDIHGRKRKHGARQNYCPNSPN
FKNAARRIVEQMAKRYKDHPAIIMWHISNEYGPYCYCENCAKAFREWLKERYKTLDELNK
RWNTAFWGHTFYDWDEIEVPSYLNEEYEYMPGRQKSSFQGLSLDYKRFMSDSLLNLYKME
VEIIKKYMPDVPVTTNLMGPFKPLDYHKWAQYMDVVSWDNYPSIKDSPHSIAFKHDLMRG
LKRDQSFILMEQTPSQTNWQWYNSAKRPGMIRLLSYHAIAHGADSVLYFQWRQSVGSCEK
FHSAMVPHAGHLNTRVSKELKQIGDELLRLDEILESVNKSDVALLFDWENWWALEESMGF
RNDISYLEHIDSYYKALYKLKTNVDVVDPTEDLSRYKLVVAPLLYLLDSNTAKNIEEYVK
NGGIFITTFLSGLVDENDRVILGGYPGWFRKLLGIWIEEIDALFPDMKNAIILEKPLGTL
DGRYECDFICDVIHSEGAKVLAYYEQDYYKGMPAILENTYGSGKSVYIGTRPEQKVIEGL
IKYYADMAGVKPILPVPEGVEVTKRTKDGKEYIFLLNFNNYDVCIELPQEFYELITQKLF
GGRVVLRAKEVMILRK
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaatcaaactgaaaaaattcctttatggcggagattataatcctgaccagtgg
tcagaagatgtttgggaacaagatattgagtttatgaagtattacaatgtaaatgcagtg
tcaatgccaatattctcatgggctcagcttcagccaagtgaggacaagtttacgtttgag
tggcttgacagaataattgataagctctattcaaatggtattcatgtcatcttagcaaca
ccaacagcatctcaacctgcgtggctgtcaaaaaagtatcctgacgtattgcctgttgat
attcatggaagaaagagaaaacatggggcaaggcagaattactgccccaacagtccaaac
ttcaaaaatgcagcaagaagaattgttgaacagatggcaaaaagatacaaagaccatccg
gcgattataatgtggcatatcagcaacgaatatggtccttactgctactgtgaaaactgc
gctaaagcctttagagagtggctaaaagaaagatataaaacattggatgagcttaacaag
agatggaacacagctttctggggacatacattctatgattgggatgagatagaagttcca
tcgtatctgaacgaagaatatgaatatatgccaggcagacaaaaaagctcattccaggga
ctttcgcttgattacaaaaggtttatgtcagacagccttctaaatctttataagatggaa
gttgagattatcaaaaaatacatgccagatgtgcctgttacaacaaaccttatgggtcca
tttaaaccactcgattaccataaatgggcacagtatatggatgtagtttcgtgggacaat
tatccttctatcaaagactctccacattctatagctttcaagcatgaccttatgcgagga
cttaaaagggaccagtcatttatattaatggaacagacaccaagccagacaaattggcag
tggtataattcagcaaaacgccctggaatgataagacttttgagctaccatgcaatagct
catggtgcggactctgttttgtatttccagtggagacagtcggttgggtcgtgtgaaaaa
ttccactctgcaatggtaccacatgctgggcacttgaatacaagggttagcaaagagcta
aaacaaattggcgatgagcttttgcgcttagatgagattttagaatcagtaaacaaaagc
gatgtagcacttttgtttgactgggaaaactggtgggcacttgaagagagtatgggattt
agaaatgacatttcgtatttagagcacattgattcgtattacaaggctttgtataaactc
aaaacaaacgtagatgttgttgacccaaccgaagatttatcaaggtataaacttgttgtt
gcaccacttttgtatttgctcgatagcaatactgcaaagaatatagaagagtacgtgaaa
aatggaggaatatttattaccaccttcctatcaggtcttgttgatgagaacgacagggta
attcttggaggatatcctggctggttcagaaaacttttgggaatctggattgaggagatt
gatgcgctctttccagatatgaaaaacgcaatcattcttgagaagccacttggaacactt
gatggcaggtatgagtgcgactttatatgtgatgtcattcactcagaaggagcaaaagtg
cttgcttattatgagcaggactattataaagggatgccagctattttggaaaatacatat
ggcagtggcaagtcagtgtatataggtacaagaccagagcaaaaggttatagaaggactt
atcaagtactatgctgatatggctggtgtaaaaccaattttgcctgtaccagaaggtgtt
gaggttacaaaacgaacaaaggatggaaaagagtatattttccttttaaatttcaataat
tacgatgtatgtattgagttgccacaagaattctatgaactgataacgcaaaagctattt
ggtggcagagtagttctgagagcaaaagaagttatgatattaagaaaataa

DBGET integrated database retrieval system