KEGG   Caldicellulosiruptor saccharolyticus: Csac_1079Help
Entry
Csac_1079         CDS       T00506                                 

Definition
cellulase (EC:3.2.1.4 3.2.1.91)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
K01225  
cellulose 1,4-beta-cellobiosidase [EC:3.2.1.91]
Organism
csc  Caldicellulosiruptor saccharolyticus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Csac_1079
Enzymes [BR:csc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Csac_1079
    3.2.1.91  cellulose 1,4-beta-cellobiosidase (non-reducing end)
     Csac_1079
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1219708..1223091
Genome map
AA seq 1127 aa AA seqDB search
MLKLKKAIKRITLCVAVVFLLQILFLFSGYNNSDVKAATTFNYGEALQKAIMFYEFQMSG
KLPSWIRNNWRGDSGLNDGKDVGLDLTGGWHDAGDHVKFNLPMSYSASMLSWAVYEYKAA
FEKSGQLEHILNQIEWVNDYFVKCHPSKYVYYYQVGDPIEDHNFWGPAEVMQMKRPAYKC
DLNNPASSVVAETAASLAAASIVIRERNSQKADTYLQHAIELFDFADRTRSDAGYTAATG
FYTSGGFIDDLGWAAVWLYLATNDKSYLDKAETLMAEYAGGTNTWTQCWDDVRYGAILLL
AKITNKDIYKGAVERNLDHWTYNITYTPKGLAWLTGWGSLRYATTAAFLAFVYADWSGCP
ENKRTAYLKFGESQINYALGSTGRSFLVGFGQNYPQHPHHRNAHSSWANSMRIPEYHRHI
LYGALVGGPGSDDSYNDDITDYVQNEVACDYNAGIVGALAKMYLMYGGDPIPNFKAIEKP
TNDEIFVESKFGNSQGANYTEIISYIYNRTGWPPRVTDNLNFKYFIDLSELIKAGYGPDI
VKVETYYSEGGKISGPYVWNASKNIYYILVDFTGTKIYPGGEVEHKKQAQFKISVPQGVP
WDPTNDPSYAGLTKELSKNKFIAAYEGNVLVWGQEPEGSSSSTPTPTPVPTVTVTPTPTP
TVTVTPTPTPTVTATPTPTPTPVSTPATGGQIKVLYANKETNSTTNTIRPWLKVVNSGSS
SIDLSRVTIRYWYTVDGERAQSAVSDWAQIGASNVTFKFVKLSSSVSGADYYLEIGFKSG
AGQLQPGKDTGEIQIRFNKDDWSNYNQGNDWSWLQSMTSYGENEKVTAYIDGVLVWGQEP
SGATPAPAPTATSTPTPTVTPTPTPTVTVTPTPTPTVTATPTPTPTPVSTPATGGQIKVL
YANKETNSTTNTIRPWLKVVNSGSSSIDLSRVTIRYWYTVDGERAQSAISDWAQIGASNV
TFKFVKLSSSVSGADYYLEIGFKSGAGQLQPGKDTGEIQIRFNKDDWSNYNQGNDWSWLQ
SMTSYGENEKVTAYIDGVLVWGQEPSGTTPAPTSTPTVTVTPTPTPTPTPTPTVTPTPTP
TPGNGLARIDTSTLVGTNQHTVGIEIDLIRHCVESGMGYELCEGSAE
NT seq 3384 nt NT seq  +upstreamnt  +downstreamnt
atgcttaaactaaaaaaagcaataaaaaggataacactgtgtgttgctgtggtatttcta
ttgcagattttatttctattttcaggatacaataacagtgatgtgaaagcagcaacaacc
tttaactatggtgaagctcttcaaaaagcaattatgttttatgaattccagatgtcaggt
aaactgccatcatggatccgcaacaactggcgaggagattctggtctaaatgatggtaaa
gatgtaggcttggatcttacaggtggctggcatgatgcaggcgatcatgtaaagtttaat
ctaccaatgtcatacagtgcttcaatgctttcgtgggcagtttatgagtataaagcagca
tttgagaaaagtggccagcttgaacatatacttaaccagatagaatgggtaaacgactac
tttgtaaaatgccatccatcaaagtatgtatactactatcaagttggtgatccaattgaa
gatcataacttctggggaccagcagaagttatgcaaatgaaacggccagcatacaagtgt
gatttaaataatccagcaagttcagttgttgcagaaacagctgcatccttggctgcagct
tcaatcgttatacgtgaaagaaacagtcaaaaggcagacacatatttgcagcatgcgata
gaactctttgattttgctgatagaactcgtagcgatgcagggtatactgcagcaaccggc
ttttacacatcaggtggctttattgatgatcttggctgggcggcagtgtggttatatctt
gcgacaaatgacaaatcatatttggataaagctgagacgcttatggcagaatatgccggt
ggcacaaatacatggacacagtgctgggatgatgtaagatacggagcaatcttactttta
gcaaagattactaataaagacatatataaaggtgctgttgaaagaaatcttgatcattgg
acatataacataacatatacacctaagggtcttgcatggctaacagggtggggctcactt
aggtatgctacaactgcagctttcttagcgtttgtttatgcagattggtcgggatgtcca
gaaaataagcgaacagcttatctaaaatttggtgagagtcagattaactatgcattaggt
tcaacaggaagaagctttttggtaggatttggacaaaattatccacaacatccacatcat
agaaatgcacatagttcatgggcgaacagtatgcgaatacccgaatatcatcgacacata
ctttatggtgcattagtaggtggaccaggctctgatgatagttacaatgatgatattact
gactatgtacaaaacgaggtggcttgtgactacaatgctggtattgttggtgctctagca
aaaatgtaccttatgtatggaggagacccaatacctaatttcaaagctatcgaaaagcca
actaatgatgaaatttttgttgaatccaagtttggtaattcacagggtgcaaactatact
gaaataatttcatacatttataacagaacgggatggccaccacgggtcacagataattta
aactttaagtattttattgacctaagtgagttaatcaaggctgggtatggtcctgatatt
gttaaagtagagacatattattcggaaggtggaaaaatatctggaccatacgtatggaat
gcgtcaaagaacatttactatatattggttgattttacaggaacaaaaatatacccaggt
ggggaagtagaacacaaaaaacaagctcaatttaagatctctgtaccacaaggcgttcca
tgggatccaactaatgacccatcttatgcaggattaacaaaagaacttagtaagaataaa
ttcatagcagcttatgaaggtaatgtgctggtatggggacaagaaccagagggatcctca
agttcaacgccaacaccaacacctgtgccgacggtgacagtaacaccgacgccgacaccg
acagtaacagtaacgccaaccccgacgccgacagtaacagcgactccaacacctacacct
acacctgttagcacacctgcgacaggtgggcagataaaggtactgtatgctaacaaggag
acaaacagcactacaaacacgataaggccatggttgaaggtagtgaatagtggcagcagt
agtatagatttgagcagggtaacgataaggtactggtacacggtagatggtgagagggca
cagagtgcggtatcagactgggcacagataggagcaagcaatgtaacattcaagtttgta
aagctgagcagtagtgtaagtggagcggattattacttggagataggatttaagagtgga
gcagggcagttacagcctgggaaggacacaggagagatacagataagatttaacaaggat
gactggagcaattacaatcaggggaatgactggtcatggttacagagcatgacgagttat
ggagagaatgagaaggtaacggcgtatatagatggtgtgctggtatggggacaggagccg
agtggagcgacacctgcgccagccccgacagcgacgtcgacacctacaccaacagtaaca
ccgacgccgacaccgacagtaacagtaacgccaaccccgacgccgacagtaacagcgact
ccaacacctacacctacacctgttagcacacctgcgacaggtgggcagataaaggtactg
tatgctaacaaggagacaaacagcactacaaacacgataaggccatggttgaaggtagtg
aatagtggcagcagtagtatagatttgagcagggtaacgataaggtactggtacacggta
gatggtgagagggcacagagtgcgatatcagactgggcacagataggagcaagcaatgta
acattcaagtttgtgaagctgagtagtagtgtaagtggagcggactattacttggagata
ggatttaagagtggagcagggcagttgcagcctgggaaggacacaggagagatacagata
agatttaacaaggatgactggagcaattacaatcaggggaatgactggtcatggttacag
agcatgacgagttatggagagaatgagaaggtaacggcgtatatagatggtgtgctggta
tggggacaggagccgagtggaacaacacctgcgccgacgtcaacaccgacagtaacggta
acaccaacaccgacacccacaccaacacctacaccaacagtaacaccgacaccaacacca
acaccgggtaatggattagcaagaattgatacaagcacattggtagggactaatcagcac
actgttggtatagagatagacttgatacggcattgcgtggaatcaggcatggggtatgaa
ctctgtgagggtagtgctgagtaa

DBGET integrated database retrieval system