KEGG   Caldicellulosiruptor saccharolyticus: Csac_1154Help
Entry
Csac_1154         CDS       T00506                                 

Definition
xylose isomerase domain-containing protein
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
csc  Caldicellulosiruptor saccharolyticus
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Csac_1154
   00051 Fructose and mannose metabolism
    Csac_1154
Enzymes [BR:csc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     Csac_1154
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1308824..1309966)
Genome map
AA seq 380 aa AA seqDB search
MLENTSYQMKRRSVDELIQHLKTFELDLKFSVGIWYFSDHPSRFHAPLGEPKTIEERLEI
IAKLKDYGVCALEAHYPNEINEDNLELYKKFSRDTGIKILSVIPNLFYENDFEFSSLASP
IEEVRKKAIERLKTSLMLNKELDCEFCIIWPGGDGYENQFGIDFIRMRDRFAEGIAEAMD
AVPGVKVAIEPKPYEPRGRIIYGLTGEGILLAQKVEKLLQNPENKKILEDDSLVGLNPEV
GHVLMGFEDLAYAFSLALEYGKLYHTHWNSQPLGNYDQDLNVGVISPEQAEAALYVMKMY
GYRGYFGIDINPERMPVERAVINSIDAIKAMNDRINNLPHEDIIACTEKPHKNRGLLEAI
LIRARANNPSILSPMPKVER
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgcttgaaaacacaagctatcagatgaaaagaagaagcgttgatgagctgattcagcac
cttaagacatttgagcttgaccttaaattttctgttggtatctggtatttttcagaccat
ccaagcagattccatgcaccacttggcgaaccaaaaacaattgaagaaagacttgaaatc
atagcaaagcttaaagactatggagtttgcgctttagaggctcattatccaaacgaaatt
aacgaagacaacttagagctttacaaaaagttttcaagagatacaggaataaagatttta
tcagtaattcctaatttgttttatgaaaacgatttcgaattttcatcactcgcctcaccc
attgaagaagtaagaaaaaaggctatcgagagacttaaaacgtctttgatgctaaacaaa
gagcttgactgtgaattctgtattatctggccaggtggagatggatacgaaaaccaattt
ggaattgactttataagaatgagagacaggtttgctgaaggtattgctgaagcaatggat
gctgtgccaggtgtaaaggttgcaattgagccaaaaccatatgagccaagaggaagaata
atttacgggctgactggcgaaggtatacttcttgcacaaaaggttgaaaaactgctgcaa
aaccctgaaaataaaaagattttagaggatgactctttagttggtcttaatcctgaagtt
ggacatgttttgatgggatttgaggatttggcgtatgcattttcacttgcacttgagtat
ggaaagctctatcatacacactggaacagccaaccacttggaaattatgaccaagattta
aacgtcggtgttatctcacctgaacaggcagaagcagcactttatgtcatgaagatgtat
ggttacaggggatattttggaattgacataaatccagagagaatgccagttgaacgagct
gttataaactcgattgatgcgataaaagcaatgaatgacagaattaataacctgccacat
gaggatataatcgcatgcacagaaaagccacacaaaaatagaggcttacttgaggcaatt
ttgataagagcaagggcaaataacccttcaatcttatcgcccatgccaaaggtggaaagg
taa

DBGET integrated database retrieval system