KEGG   Caldicellulosiruptor saccharolyticus: Csac_1221Help
Entry
Csac_1221         CDS       T00506                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
csc  Caldicellulosiruptor saccharolyticus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:csc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Csac_1221
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Csac_1221
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Csac_1221
Enzymes [BR:csc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Csac_1221
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1384527..1386008
Genome map
AA seq 493 aa AA seqDB search
MEFVSTRGDQKVLSKEAIYLGIANNGGLFTPVSIPKIDFEHLKELNSYKEVARYIFSLYL
TDFSKEEIDDCIEKAYATGKFDTKDVVELKKLDSSLFALELWHGPTYAFKDVALQVLPHL
LIRSMPDSYKKALILVATSGDTGKAALEGFRDVEKTKIVVFYPSEGVSDVQKRQMTTQEG
KNTYVAGIIGNFDDAQSGVKEIFTNPRYVETINKMGYFFTSANSINFGRLLPQIVYYIWS
YLELLRNGFIKESEKLNFVVPTGNFGNILAGYFAKRMGLPINRLIVASNINSVVSDFIKT
GIYDRRREFYKTISPSMDILVASNLERLLYLVTGNFEMVKKYMLDLRENGYFKVENDVLK
SIQSDFWGDFSTDIETKKAIKRVYKEFSYLIDTHSAVGFDVYRKYHDKTSDVTKTVILQT
ANPYKFAKDVLNALFDDEYNNIDPFEAVEVLYQKTKVDIPDGIKRLLSKAVLHPDVIEKD
KMFDFILEKIKDN
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggagtttgtgagtacgcgaggagaccagaaggtgctctcaaaagaagcaatttacctt
ggaatagcaaacaatggagggctttttaccccagttagtataccaaaaattgattttgag
catttaaaagagctaaatagttacaaagaagttgcaaggtatatcttttcactttatctt
acagacttttctaaagaagagattgatgattgtatagaaaaagcatatgcaactggtaaa
tttgatacaaaagatgtagttgagctaaagaagcttgacagtagcctgtttgcgcttgag
ctttggcatgggccaacttatgcctttaaagatgttgcgctacaagtgctgccacacctt
ttgataaggtcaatgccagatagctataaaaaagcactcatattggttgcaacatctggc
gatacaggaaaagctgccctggagggttttagagatgtcgagaagaccaagattgtagtc
ttttatccctctgaaggtgtgtctgacgtacaaaaaagacagatgacaactcaggaaggc
aagaacacttatgttgcagggataataggcaactttgacgatgctcaaagtggtgtaaag
gagatctttacaaatccaagatatgtagagaccattaataaaatgggctattttttcaca
tcagcaaactctataaactttgggcgacttttgcctcagattgtctactatatctggagc
tacttagagcttttgagaaatggatttataaaggaaagtgaaaagctaaactttgttgtg
ccaacagggaattttggaaatatcttggctgggtactttgcaaagcgtatgggccttcca
ataaatagacttattgttgcatcaaacataaactctgttgtttctgattttattaaaaca
ggtatttatgacagacgaagagagttttataaaacaatatcaccatctatggatatattg
gttgccagcaatttagaaaggcttttgtacttggtcacaggcaactttgagatggtgaaa
aaatacatgttagatttgagagagaatgggtattttaaagttgaaaatgatgttttaaag
tcaatacaatcagatttctggggagatttttcaacagatattgaaactaaaaaggcaata
aaacgagtttacaaagagttttcttatcttattgacacgcattcagcagtcggatttgat
gtttatagaaaataccacgataaaacttctgatgtgacaaagacagtaattttgcagact
gcaaacccatacaagtttgccaaggatgttctcaacgccttgtttgatgatgaatataat
aatattgatccgtttgaagcagtcgaagttctgtaccaaaaaacaaaggtcgatattcca
gatggaataaagagacttttgtcaaaagcggtcttgcaccctgatgtgattgaaaaagac
aaaatgtttgattttatcttagagaaaataaaagataactga

DBGET integrated database retrieval system