KEGG   Caldicellulosiruptor saccharolyticus: Csac_1339Help
Entry
Csac_1339         CDS       T00506                                 

Definition
L-fucose isomerase (EC:5.3.1.25)
Orthology
K01818  
L-fucose isomerase [EC:5.3.1.25]
Organism
csc  Caldicellulosiruptor saccharolyticus
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:csc00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Csac_1339
Enzymes [BR:csc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.25  L-fucose isomerase
     Csac_1339
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1506468..1508282
Genome map
AA seq 604 aa AA seqDB search
MSNERLNVFIGEKRFVEDYPKVGIRPTIDGRYGGVRESLEEQTWRLAKSVAEFIEKNVYL
PNGGKVKCVLPPRCIGGVVEARMADELFKKEGVGLSITVTPCWCYGSETMDMTLDIPKAV
WGFNGTERPGAVYLAAVSAAHNQKGLPVFKIYGKDVQDKDDFSIPQDVQEKILKFVKSAL
AVSIMKNKSYLSIGNVSMGIAGSIVDPDFFEDYLGMRVEYVDMSEIIRRIEEKIYDQEEF
ERAIQWVRNNCKEGEDPNPPEKRVDRKKKDEVWEFVVKMAIITRDLMIGNKKLEALGYPE
EALGHNAILAGFQGQRQWTDHFPNGDFMETILNSSFDWNGLRQPYILATENDSLNGVCML
FGHLLTNTAQIFADVRTYWSEGAIYRVTGWKPEGLAQNGVIHLINSGSAALDGTGQQEID
GKPAIKPFWEITEEEVRKCLETTRFCYANLGYFRGGGFSTKFVTRGGMPVTISRLNIVKG
LGPVLQIAEGWTVELPPNVHEILDRRTDPTWPTTWFVPKLTGKGAFKSAYSVMENWGANH
CAITYGHVGDLFITLATMLRIPVCMHNVEEERIFRPSAWSAFGTEDLEGADFRACKNFGP
LYKK
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaatgaaagattgaatgtttttataggtgaaaaaagatttgttgaagattacccc
aaggtgggtataagaccaactatagatggaagatatggtggagtaagggaatcactggaa
gagcagacatggagattagcaaaatcggtagcagaatttattgaaaagaatgtttatttg
ccaaatggggggaaggtaaagtgtgtgcttccacctcgatgcattggtggtgttgttgaa
gcaagaatggcagatgaacttttcaagaaagaaggagttggcctttctataacagtcacg
ccctgctggtgttatggttccgaaacaatggacatgacactggatattccaaaagctgta
tggggatttaatggtacagaaagaccgggtgctgtatatcttgctgcagtgtcggccgct
cacaatcaaaaagggttacctgtctttaagatatatgggaaggatgttcaagacaaagat
gatttttcaattcctcaagatgtccaagaaaagattttaaagtttgtaaaaagtgcttta
gcagtttctataatgaaaaataagtcctatctttcaattggaaacgtgtcgatgggaatt
gcaggttctattgttgaccctgacttttttgaagactatcttgggatgagagttgagtat
gttgacatgtcagagataataaggcgaatagaagaaaagatatacgaccaagaagaattt
gaaagggcaatacagtgggtgaggaataattgtaaggaaggagaagatcctaatccacca
gagaaaagagttgacagaaaaaagaaggatgaggtatgggaatttgtggtcaagatggct
ataataacaagagatttaatgattggtaacaaaaagcttgaagcattaggttatcccgaa
gaagcacttggacataatgcaattttagcaggatttcaaggacagcggcagtggacagat
cattttccaaacggtgattttatggaaacaattctcaactcctcatttgactggaatgga
ctgagacagccctacatacttgcaactgagaatgatagcttaaacggtgtatgtatgtta
tttgggcatcttcttacaaatacagctcaaatttttgcagacgttcgaacatattggagc
gaaggtgctatttatagagttactggatggaaaccagaaggacttgctcaaaatggggtt
attcatcttataaattcaggttcagcagcactggacggaacaggtcagcaagagattgac
ggcaagcctgctataaaacctttctgggaaatcactgaagaagaagttagaaagtgttta
gaaacaacaagattctgttatgcaaatttgggctattttagaggtggcggattttcaaca
aaatttgtgacaagaggtggtatgcctgttacaatctcaagattaaatattgttaaaggg
ttgggacctgttcttcagattgcagaaggctggacagtagaacttcctccaaatgttcat
gaaatacttgacagaaggacagacccgacatggccaaccacatggtttgtaccaaaacta
actggcaagggagcatttaagagcgcatactctgtgatggaaaactggggagcaaatcac
tgtgcgataacctatggacatgtaggtgatttgtttatcacattggcaactatgttaagg
attccagtgtgcatgcacaatgtagaagaagaaagaatattcagaccaagtgcttggagt
gcgtttggaacagaagacttagaaggtgcagattttagagcatgcaagaattttgggcca
ctttataagaaataa

DBGET integrated database retrieval system