KEGG   Caldicellulosiruptor saccharolyticus: Csac_1459Help
Entry
Csac_1459         CDS       T00506                                 

Definition
(GenBank) pyruvate ferredoxin/flavodoxin oxidoreductase, delta subunit
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
csc  Caldicellulosiruptor saccharolyticus
Pathway
csc00010  Glycolysis / Gluconeogenesis
csc00020  Citrate cycle (TCA cycle)
csc00620  Pyruvate metabolism
csc00633  Nitrotoluene degradation
csc00640  Propanoate metabolism
csc00650  Butanoate metabolism
csc00680  Methane metabolism
csc01100  Metabolic pathways
csc01120  Microbial metabolism in diverse environments
csc01130  Biosynthesis of antibiotics
csc01200  Carbon metabolism
Module
csc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:csc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Csac_1459
   00020 Citrate cycle (TCA cycle)
    Csac_1459
   00620 Pyruvate metabolism
    Csac_1459
   00640 Propanoate metabolism
    Csac_1459
   00650 Butanoate metabolism
    Csac_1459
  Energy metabolism
   00680 Methane metabolism
    Csac_1459
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Csac_1459
Enzymes [BR:csc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Csac_1459
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_21 Fer4_6 Fer4_2 Fer4_7 Fer4_10 Fer4_9 Fer4_16 Fer4_4 Fer4_13 Fer4_15 Fer4_3 Fer4_17
Motif
Other DBs
NCBI-ProteinID: ABP67059
JGI: Csac_1459
UniProt: A4XJH4
Position
1620918..1621217
Genome map
AA seq 99 aa AA seqDB search
MRKMRVTEESTWKELTPAGIIIDAGNAEDFKTGDWRTMRPVWHEDKCKQCLFCFYVCPDS
SIKIENGKMVGVDYDHCKGCGVCTEVCPFKAFDFVEEQK
NT seq 300 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaatgagggtaacagaggaatcaacatggaaggaattgacacctgcgggtata
ataattgatgcaggaaatgcagaggatttcaaaacaggcgactggagaacaatgagacct
gtttggcatgaagataaatgcaagcagtgcctattttgcttctatgtatgtccagattca
tctataaagattgaaaatggcaagatggttggcgttgattatgaccattgcaaaggttgt
ggtgtttgcacagaagtttgtccatttaaggcttttgactttgtagaagaacagaagtaa

DBGET integrated database retrieval system