KEGG   Caldicellulosiruptor saccharolyticus: Csac_1461Help
Entry
Csac_1461         CDS       T00506                                 

Definition
(GenBank) thiamine pyrophosphate enzyme domain protein TPP-binding protein
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
csc  Caldicellulosiruptor saccharolyticus
Pathway
csc00010  Glycolysis / Gluconeogenesis
csc00020  Citrate cycle (TCA cycle)
csc00620  Pyruvate metabolism
csc00633  Nitrotoluene degradation
csc00640  Propanoate metabolism
csc00650  Butanoate metabolism
csc00680  Methane metabolism
csc01100  Metabolic pathways
csc01120  Microbial metabolism in diverse environments
csc01130  Biosynthesis of antibiotics
csc01200  Carbon metabolism
Module
csc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:csc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Csac_1461
   00020 Citrate cycle (TCA cycle)
    Csac_1461
   00620 Pyruvate metabolism
    Csac_1461
   00640 Propanoate metabolism
    Csac_1461
   00650 Butanoate metabolism
    Csac_1461
  Energy metabolism
   00680 Methane metabolism
    Csac_1461
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Csac_1461
Enzymes [BR:csc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Csac_1461
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: ABP67061
JGI: Csac_1461
UniProt: A4XJH6
Position
1622443..1623381
Genome map
AA seq 312 aa AA seqDB search
MAYNIKELAARPERFTGGHRMCAGCGAPVAVRAILRALKPEDRAVVGVATGCLEVSSCIY
PYTAWKDSFIHSAFENAAATIAGAEAAYRVLKKKGKVQGEFKFIAFGGDGGTYDIGLQSL
SGAMERGHNMVYVCYDNGAYMNTGIQRSSATPLYADTTTSPQGKVLPGKMQWRKDLTEIM
VAHGIPYVAQTAFITPNLKDLIEKAEKALYTDGPAFLNVLAPCPRGWRYETSKLIEISKL
AVDTCFWPLYEVVNGQYRLTYKPKEKLPVVEFLKTQGRFRHLFKKGNEHLIEQIQQEVDR
RWERLLELCGEK
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggcatacaatataaaagagcttgctgcaagacctgaaagatttacaggcgggcacaga
atgtgcgcaggctgcggtgcgcccgttgctgtaagagcaattttaagagctttaaagcca
gaagacagagcagttgttggtgttgcaacaggttgtttggaggtttcaagctgtatttat
ccgtacacagcatggaaggattcatttatccacagtgcatttgaaaacgctgctgcaaca
attgcaggtgctgaggcagcgtacagggttttgaagaaaaaaggaaaagttcaaggtgaa
tttaaattcatcgcattcggtggcgatggtggaacatacgatataggtcttcagtcgctt
tccggtgcaatggaaagaggtcacaacatggtatatgtttgctatgacaacggtgcttat
atgaacacaggtatccagagatcttctgctacaccactttatgctgatacaacaacatct
ccacagggtaaagtacttccaggtaagatgcagtggagaaaggatttaactgaaatcatg
gttgcacatggaattccatatgttgcacagacagctttcattacacccaacctcaaagac
ttgattgaaaaggctgaaaaggctctttacaccgatggaccagcatttttaaatgttttg
gctccatgtccaagaggttggagatatgaaacatcaaagctaattgaaatttcaaaactt
gcagttgatacatgcttctggccactttacgaggttgtaaatgggcagtatcgtctcaca
tacaagccaaaagaaaagcttcctgttgttgagttcttaaagacacaggggagattcaga
cacctattcaagaaaggaaatgagcatctaattgagcagattcagcaggaagttgataga
agatgggagagacttttagagctttgtggtgaaaagtaa

DBGET integrated database retrieval system