KEGG   Caldicellulosiruptor saccharolyticus: Csac_1562Help
Entry
Csac_1562         CDS       T00506                                 

Definition
alpha-galactosidase
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
csc  Caldicellulosiruptor saccharolyticus
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:csc00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Csac_1562
  Lipid metabolism
   00561 Glycerolipid metabolism
    Csac_1562
   00600 Sphingolipid metabolism
    Csac_1562
Enzymes [BR:csc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Csac_1562
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1722070..1723386
Genome map
AA seq 438 aa AA seqDB search
MLKIAIIGAGSGVFTRNLVRDILSYPELRDSTIALMDIDSVRLEFMRRALQKLIDQEKYP
TKLEATTDRKEALKGAKYVIVTIQVGGLKPYEYDIYIPLKYGVKQAVGDTLGPGGVFRAL
RTIPVLLDIAKDMEELCPDALLLNYVNPMAMNCWALNKVTNIKNVGLCHSVQGTAEFLAK
IIEAKMEEISYLCAGINHMAWFLKFEWNGKDAYPLIREKANDPEIYTQDVTKFEILKHFG
YYVTESSFHMSEYVPYFRKSDDWINKIHRTHSWHKEHYNGMYLHCCLDAAKTLLEDLKKM
AEADYIDPKRSNEYCATIIHSIETNTPAVINGNVENKSLITNLPEGCCVEVPCLVDKNGI
QPTYVGDLPPQLAALNRTNINVQELTVLAALMGDREAVYHAIMMDPLTSAVLDLDEIRKM
VDEMFEAEKEWLPEKFYR
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaaatagccataataggtgcaggaagcggagtttttacgaggaacttggtaaga
gacattttatcatatccagagctaagagactctacaatagcgcttatggacattgacagt
gtaaggcttgaatttatgagaagagctctgcaaaaactcattgatcaggaaaaatatcca
accaaacttgaagccacaaccgatagaaaagaggctttaaaaggtgcaaaatatgttatt
gtcacaatacaagttggaggtttaaaaccttacgaatatgacatttacattcctctaaaa
tatggtgtaaaacaggcggttggtgatacattaggtccaggtggagttttcagggctttg
cgaacaataccggttttacttgacattgcaaaggacatggaagagctgtgtcctgacgca
cttttacttaactatgtaaatccaatggcaatgaattgctgggcgttaaataaggttacg
aatataaaaaatgtagggctttgtcacagtgttcaaggaactgctgaatttttagcaaag
attattgaggcaaaaatggaagagatttcatacttatgcgcaggtataaaccacatggca
tggtttttaaaatttgagtggaatgggaaagatgcatatcctcttataagagaaaaggca
aacgacccggaaatttacacacaagatgtgactaaatttgagatactaaaacattttgga
tattatgtaacagagtcaagttttcacatgtctgaatatgttccctattttagaaagagc
gacgattggataaataaaatccatagaacccattcatggcacaaagaacattacaatggt
atgtatttgcattgctgcttagatgctgcgaaaactttgcttgaggacctgaaaaaaatg
gcagaggcagactacatcgacccgaaaagaagtaacgaatactgtgcaactatcatccat
tccatagagacaaatactccagctgtgataaatggtaatgttgaaaataaaagtttgatt
acaaatctacctgaaggatgttgtgttgaagtaccatgtttggttgacaaaaatggtatt
cagccaacttatgttggagatcttcctccacagcttgcagctttgaacagaacaaatata
aatgttcaagagctaactgttcttgctgctttgatgggtgatagggaagcagtttatcat
gcaattatgatggaccctctcacaagcgctgttttagatttggatgaaatacgcaagatg
gtagatgagatgtttgaagcagaaaaagaatggttgccagagaagttttataggtaa

DBGET integrated database retrieval system