KEGG   Caldicellulosiruptor saccharolyticus: Csac_1594Help
Entry
Csac_1594         CDS       T00506                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
csc  Caldicellulosiruptor saccharolyticus
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:csc03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1754909..1755508
Genome map
AA seq 199 aa AA seqDB search
MQAKENAISKLIQQLEKLPGIGQKTAQRLAFYIINMKNEDVKALAEAILSAKNSTKLCKI
CCNFTEGDICHICSDDKRDRSIICVVEEPQDVVALEKVKEYKGLYHVLHGAISPLKGKYP
EQLTIDVLLKRLADTNVKEVIIATNPDVDGEATASYLARLIKPMGIKVTRIARGIPVGGD
IEYADEVTILKAIEGRKEI
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcaaaagaaaatgctatctcaaaacttatccagcagcttgaaaaactgcctggc
ataggccaaaaaactgcacagaggcttgctttttatataattaatatgaaaaatgaagat
gtaaaagcattggcagaggcaatcttaagtgccaaaaatagcacaaaattgtgcaaaata
tgttgcaactttacagaaggtgatatttgtcatatatgcagtgacgataaaagagacaga
agcataatttgtgttgttgaggagcctcaggatgttgtagcccttgaaaaggtaaaagaa
tacaagggactttaccatgtactgcatggtgcaatatcaccgctcaaaggtaaatatcct
gaacagctgacaattgatgttcttctaaaaagacttgctgatactaatgtaaaagaagta
ataattgctacaaacccggatgtggatggtgaggcaacagcgtcatacttggcaagactt
ataaagccaatgggtattaaagtgacaagaattgcccgtggtattccggttggcggtgat
attgaatacgcagatgaggtaacaattctcaaagcaattgaaggaagaaaagagatttag

DBGET integrated database retrieval system