KEGG   Caldicellulosiruptor saccharolyticus: Csac_1600Help
Entry
Csac_1600         CDS       T00506                                 

Definition
(RefSeq) UTP-glucose-1-phosphate uridylyltransferase GalU
  KO
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
csc  Caldicellulosiruptor saccharolyticus
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:csc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Csac_1600
   00052 Galactose metabolism
    Csac_1600
   00500 Starch and sucrose metabolism
    Csac_1600
   00520 Amino sugar and nucleotide sugar metabolism
    Csac_1600
Enzymes [BR:csc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Csac_1600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1758573..1759481
Genome map
AA seq 302 aa AA seqDB search
MKKLIKKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIVEEALESGIESILIVTGR
GKRAIEDHFDKSFELEVALENKKDFDSLQMIRKIADYNVHYIRQKEPRGLGDAVYCARLF
IDNEPFAVLLGDDIIISDKPCLKQLIEVYEEYRTTILGVQKVPEEDVSKYGIVAGKQIED
RIYKVKDLVEKPKKEESPSNIAVLGRYIITPEILNILEHTKEGIGGEIQLTDALRELSKK
EAMYAYEFEGKRYDVGNKLGFLQATVEIALSREDIGKDFYNYLVTIVNAKDYKEKLSQLE
KI
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagcttataaagaaagcaatcattcctgcggcaggacttgggacaagatttttg
cctgcaacaaaggcccagcccaaagagatgcttcctattgttgacaagcctacaatacag
tatatagttgaagaagcgttagaatcgggaatagagagcattttaatagtcacaggacgc
ggcaaaagagctatagaagaccattttgacaagtcatttgagcttgaggttgctcttgag
aacaaaaaggactttgatagccttcagatgataagaaagattgctgactacaatgtgcat
tatatccgtcaaaaagagccaaggggtttgggtgatgctgtttactgtgcaagacttttt
attgacaatgaaccttttgctgtacttttaggtgatgacataattatatcggacaagcct
tgtttaaaacagctaattgaggtgtacgaagagtacaggacaacaattttgggtgttcaa
aaggtaccagaagaagatgttagcaaatacggaattgttgcaggaaagcagattgaagat
agaatttacaaggtaaaagaccttgttgagaagccaaagaaggaagaatcaccttcaaat
attgctgttttgggaaggtacataatcacaccagagattttaaacatattggaacacaca
aaagaaggaattggaggagagattcagcttactgatgccttaagagagctttcaaagaaa
gaggctatgtacgcctatgagtttgaaggaaaaagatatgatgttgggaacaagcttggg
ttcttgcaggcaacagttgagattgcactttcaagagaagatatcggaaaagatttttat
aactatcttgtcacaattgtaaatgctaaagattataaagaaaaattaagtcaattagaa
aagatttaa

DBGET integrated database retrieval system