KEGG   Caldicellulosiruptor saccharolyticus: Csac_1600Help
Entry
Csac_1600         CDS       T00506                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase GalU
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
csc  Caldicellulosiruptor saccharolyticus
Pathway
csc00040  Pentose and glucuronate interconversions
csc00052  Galactose metabolism
csc00500  Starch and sucrose metabolism
csc00520  Amino sugar and nucleotide sugar metabolism
csc01100  Metabolic pathways
csc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:csc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Csac_1600
   00052 Galactose metabolism
    Csac_1600
   00500 Starch and sucrose metabolism
    Csac_1600
   00520 Amino sugar and nucleotide sugar metabolism
    Csac_1600
Enzymes [BR:csc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Csac_1600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 IspD CTP_transf_3 Smr
Motif
Other DBs
NCBI-ProteinID: ABP67192
JGI: Csac_1600
UniProt: A4XJV7
Position
1758573..1759481
Genome map
AA seq 302 aa AA seqDB search
MKKLIKKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIVEEALESGIESILIVTGR
GKRAIEDHFDKSFELEVALENKKDFDSLQMIRKIADYNVHYIRQKEPRGLGDAVYCARLF
IDNEPFAVLLGDDIIISDKPCLKQLIEVYEEYRTTILGVQKVPEEDVSKYGIVAGKQIED
RIYKVKDLVEKPKKEESPSNIAVLGRYIITPEILNILEHTKEGIGGEIQLTDALRELSKK
EAMYAYEFEGKRYDVGNKLGFLQATVEIALSREDIGKDFYNYLVTIVNAKDYKEKLSQLE
KI
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagcttataaagaaagcaatcattcctgcggcaggacttgggacaagatttttg
cctgcaacaaaggcccagcccaaagagatgcttcctattgttgacaagcctacaatacag
tatatagttgaagaagcgttagaatcgggaatagagagcattttaatagtcacaggacgc
ggcaaaagagctatagaagaccattttgacaagtcatttgagcttgaggttgctcttgag
aacaaaaaggactttgatagccttcagatgataagaaagattgctgactacaatgtgcat
tatatccgtcaaaaagagccaaggggtttgggtgatgctgtttactgtgcaagacttttt
attgacaatgaaccttttgctgtacttttaggtgatgacataattatatcggacaagcct
tgtttaaaacagctaattgaggtgtacgaagagtacaggacaacaattttgggtgttcaa
aaggtaccagaagaagatgttagcaaatacggaattgttgcaggaaagcagattgaagat
agaatttacaaggtaaaagaccttgttgagaagccaaagaaggaagaatcaccttcaaat
attgctgttttgggaaggtacataatcacaccagagattttaaacatattggaacacaca
aaagaaggaattggaggagagattcagcttactgatgccttaagagagctttcaaagaaa
gaggctatgtacgcctatgagtttgaaggaaaaagatatgatgttgggaacaagcttggg
ttcttgcaggcaacagttgagattgcactttcaagagaagatatcggaaaagatttttat
aactatcttgtcacaattgtaaatgctaaagattataaagaaaaattaagtcaattagaa
aagatttaa

DBGET integrated database retrieval system