KEGG   Caldicellulosiruptor saccharolyticus: Csac_1707Help
Entry
Csac_1707         CDS       T00506                                 

Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
csc  Caldicellulosiruptor saccharolyticus
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:csc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Csac_1707
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Csac_1707
Enzymes [BR:csc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Csac_1707
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1855827..1856633
Genome map
AA seq 268 aa AA seqDB search
MRNFGNVKKVVVKVGTSTVTYPTGKLNLSRLEKLARVLSDIKNEGRDIVLVTSGAVASGL
GRLGLTKNHKTTQEKQALAAIGQGILMQIYEKLFGEYGVVVAQVLLTKDVVDEEKKMLNV
KNTFEQLFKFGAIPIVNENDVVAIEELEFGDNDTLSAYVATIIGADLLIILSDIDGLYSC
DPRLNKDAKLIREVFEIDSYIESIAGGAGSLNSTGGMQTKIEAAKIAMQNKIPMIIANGE
NPSILRDILAGKDVGTLFICKEVLSKRE
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaactttggaaatgtaaaaaaagttgttgtaaaggttggaacaagcactgttaca
tatccaacaggcaaactaaatctttcgcgactggaaaaacttgcaagagttctttctgac
ataaaaaatgagggaagagacattgtgcttgtcacatctggtgctgttgcctcaggcttg
ggacggcttgggcttaccaaaaatcataaaacaacccaggaaaaacaggcgcttgcagct
attggccagggaattttaatgcagatttacgaaaagctttttggtgagtatggagttgtt
gttgcccaggtacttttgacaaaagatgttgttgatgaggaaaaaaagatgctgaatgtt
aaaaacacttttgaacagcttttcaagtttggtgcaattccaattgtaaatgaaaacgac
gttgttgccatcgaagagcttgaatttggcgacaatgacacgctctctgcctatgttgca
acaataattggcgcagaccttttgataattctttctgacatagacgggctttactcatgt
gacccaagactgaacaaggatgcaaagctcataagagaggtttttgagattgactcatac
atagagagcattgcaggaggagccggatctttgaactcaactggtggtatgcaaactaaa
attgaggcagcgaagattgcaatgcaaaataaaattcctatgataattgcaaatggagaa
aatccttctattttgagagacatcttagcagggaaagatgttggcacactttttatttgc
aaagaagtattatcaaagagggagtga

DBGET integrated database retrieval system