KEGG   Caldicellulosiruptor saccharolyticus: Csac_1830Help
Entry
Csac_1830         CDS       T00506                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
csc  Caldicellulosiruptor saccharolyticus
Pathway
csc00010  Glycolysis / Gluconeogenesis
csc00030  Pentose phosphate pathway
csc00051  Fructose and mannose metabolism
csc00052  Galactose metabolism
csc00680  Methane metabolism
csc01100  Metabolic pathways
csc01110  Biosynthesis of secondary metabolites
csc01120  Microbial metabolism in diverse environments
csc01130  Biosynthesis of antibiotics
csc01200  Carbon metabolism
csc01230  Biosynthesis of amino acids
csc03018  RNA degradation
Module
csc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:csc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Csac_1830
   00030 Pentose phosphate pathway
    Csac_1830
   00051 Fructose and mannose metabolism
    Csac_1830
   00052 Galactose metabolism
    Csac_1830
  Energy metabolism
   00680 Methane metabolism
    Csac_1830
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Csac_1830
Enzymes [BR:csc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Csac_1830
Protein phosphatases and associated proteins [BR:csc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Csac_1830
Messenger RNA biogenesis [BR:csc03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Csac_1830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: ABP67415
JGI: Csac_1830
UniProt: A4XKI0
Position
1973945..1974913
Genome map
AA seq 322 aa AA seqDB search
MPEVKTIGVLTSGGDAPGMNAAIRAVVRTGIYYGFRVMGIRRGYNGLIEGDIFEMNLRSV
SDIIQRGGTILLTARSPEFMTENGLKKAASMCKIFKIDALVVIGGDGSFRGARDLSKFGI
NVVGIPGTIDNDIACTDYTIGFDTALNTVQDAINKIRDTATSHERVSILEVMGRHAGYIA
LYSGIAGGAESIVIPEKGLDKDEIIRRIIDGKNKGKLHNLIILAEGIGGATELAKEIEEA
TGIETRATILGYIQRGGSPTAYDRVMASLMGARAVEVIKEGKKNRIIALKDGKIVDYDID
EALSMQKSIDEYMYDLATILSL
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgccagaagtgaagacaataggagtgctcacaagtggcggagatgcacctggaatgaat
gcagctataagggctgttgtgaggacaggaatttactatggttttagagtgatgggtata
aggcgcggatataatgggctaatagaaggcgatatatttgaaatgaatttaaggtcagtg
tctgatataattcagcgtggtggaacaatacttttgactgcgaggtctccagagtttatg
acagaaaacgggctgaaaaaagcagcttctatgtgcaaaatattcaagattgatgctctt
gtagtaattggtggagatggatcttttagaggggcaagagatttgagcaaatttggaata
aatgtagtgggtattcctggtacaattgacaatgacattgcatgtacagattatacaatt
ggttttgacactgctttaaatactgtacaagatgcaataaataagattagagacacagcc
acctctcatgagagagtcagcatattagaagtaatgggaagacatgcaggctacattgca
ctttatagtggtattgcaggtggtgctgaatccattgtaatacctgaaaagggtttagat
aaagatgagataataagaagaattattgatggtaagaacaagggaaagcttcacaattta
attatcttggcagagggaattggtggggcaacagaacttgcaaaagagattgaagaggca
acaggaattgaaacaagagcaacaattttgggttatatacaaaggggtggctcaccaact
gcatatgatagagttatggcaagccttatgggtgcaagagctgttgaagtaataaaagaa
ggaaagaagaacaggataattgccctaaaagatggaaagattgttgactatgatattgac
gaggcgctttctatgcaaaagagcattgacgagtacatgtatgacttggctacaatcttg
tctttataa

DBGET integrated database retrieval system