KEGG   Caldicellulosiruptor saccharolyticus: Csac_1880Help
Entry
Csac_1880         CDS       T00506                                 

Definition
putative agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
csc  Caldicellulosiruptor saccharolyticus
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csc00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Csac_1880
Enzymes [BR:csc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Csac_1880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2022169..2023023
Genome map
AA seq 284 aa AA seqDB search
MSFNLYKNSFLCSSNDYENSKVVLAGIPMDFTVSFKPGSRFGPSKIREVSVGLEEYSVYQ
DKNLFNKAFCDMGDLELPFGNVGKSIDIIYEFARKIFGDDKTPIFLGGEHLISFPLIKAA
KEIYGDLVVLHFDAHADMRDDYLGEKFSHATVMRRAGEVIGFNNLYQFGIRSGSEEEILF
ARKNSNIFFVYETEKLFEIIKKLRNKKVYLSIDIDVVDPAFAPGTGTPEPGGLTSSQFLE
IILKMKELDIVGADVVEVSPYYDISDRTSLLAAKIVRELILLIE
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgagttttaatctttataagaactcttttctgtgctcatcgaatgattatgaaaacagt
aaggttgtacttgctggaatacccatggattttactgtgagttttaagcctggttcgcgt
tttggaccaagcaaaataagagaagtttcagttgggcttgaggagtattcagtataccaa
gataagaatttgtttaataaagctttttgtgatatgggagatttagagcttccatttgga
aatgtgggcaaatccattgacataatatatgagtttgcaaggaaaatatttggtgatgac
aaaactcctatttttttgggtggagagcatcttatcagttttccactaataaaggcagca
aaagaaatatatggtgaccttgttgttttacactttgatgctcacgctgatatgagagat
gactacctgggtgaaaagttttctcatgcgacagtaatgagaagggcaggagaggttatt
gggtttaataatctataccaatttggcataaggtctggctctgaggaagagatattattt
gcaagaaaaaacagtaatatattttttgtttacgaaacagaaaaactttttgagataatt
aaaaaattaagaaacaaaaaggtctatttgtcaattgatatagatgttgttgatccggca
tttgcacctggtactggaacacctgagccaggggggttgacctcatcgcagtttttggaa
ataatcttgaagatgaaagagctcgacattgtgggtgctgacgttgtagaagtttctcct
tactatgatatatcagacaggacatctcttcttgccgcaaagattgtgagagaacttatc
cttttaatcgagtga

DBGET integrated database retrieval system