KEGG   Caldicellulosiruptor saccharolyticus: Csac_1931Help
Entry
Csac_1931         CDS       T00506                                 

Definition
aspartate carbamoyltransferase catalytic subunit (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
csc  Caldicellulosiruptor saccharolyticus
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csc00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Csac_1931
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Csac_1931
Enzymes [BR:csc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Csac_1931
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2073605..2074522
Genome map
AA seq 305 aa AA seqDB search
MKHLLGLRDLSKEDIIKILNLAKDMKTILKSETKKTPHLQGYSVVTLFYENSTRTRTSFE
LAAKFMSANTTSISVQTSSVQKGESLLDTVKTLEALKTDVLIVRHSVSGVPHFIAKNCSF
SVINAGDGMNEHPTQALLDMFTIRERLGTIEKLKIAIIGDILHSRVARSNIWGLSKFDNQ
ITVFGPQTLIPPYIENFAKVASSLEEAVSGKDIVIDLRIQLERQKRGFITSKQEYYKFYG
LNEDIMKFISDSTLIMHPGPVNRGVEISSEVMQLKNSTIDEQVTNGIAVRMAVLYLCTRK
EGIYR
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacatttgcttgggctaagagacctttcaaaagaggatattataaaaatactgaat
cttgcaaaagatatgaagacaattttaaagagtgaaaccaaaaagactcctcatctgcag
gggtactctgtagtgactttattttatgaaaacagcacaagaacacgaacatcgtttgaa
cttgcagcaaagtttatgagtgcaaatacaacatcaatctcggtgcaaaccagcagtgta
caaaaaggagaatctttgcttgacactgtaaaaactttggaagctctaaaaacagatgtg
ctaattgtcagacattctgtttctggcgtgccgcattttattgctaaaaactgttcattt
tcagtcataaacgctggtgatggaatgaacgagcatccaactcaggcactgcttgatatg
ttcacaataagagaaaggcttggaacaattgagaagttgaagatagcaatcattggcgat
attctccacagcagggttgcaaggagtaacatatgggggctttctaaatttgacaaccaa
ataaccgtgtttggcccgcaaactcttattccaccttatattgaaaactttgctaaggtt
gcatcttctttagaagaggcagtctcaggaaaagatattgtaatagatttgaggattcag
cttgagagacaaaaacggggctttataacatctaaacaagaatattataagttttatgga
ttgaacgaggatataatgaagtttatttcagacagcaccctgataatgcatcctggtcct
gtcaacaggggagttgaaatttcttcagaggtgatgcagcttaaaaattctacgattgat
gagcaggttacaaacggtattgctgttagaatggcggttttatacctttgcacgcgcaag
gagggaatttataggtga

DBGET integrated database retrieval system