KEGG   Caldicellulosiruptor saccharolyticus: Csac_1952Help
Entry
Csac_1952         CDS       T00506                                 

Definition
(GenBank) Phosphoglycerate kinase., Triose-phosphate isomerase
  KO
K00927  phosphoglycerate kinase [EC:2.7.2.3]
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
csc  Caldicellulosiruptor saccharolyticus
Pathway
csc00010  Glycolysis / Gluconeogenesis
csc00051  Fructose and mannose metabolism
csc00562  Inositol phosphate metabolism
csc01100  Metabolic pathways
csc01110  Biosynthesis of secondary metabolites
csc01120  Microbial metabolism in diverse environments
csc01130  Biosynthesis of antibiotics
csc01200  Carbon metabolism
csc01230  Biosynthesis of amino acids
Module
csc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
csc_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:csc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Csac_1952
   00051 Fructose and mannose metabolism
    Csac_1952
   00562 Inositol phosphate metabolism
    Csac_1952
Enzymes [BR:csc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.3  phosphoglycerate kinase
     Csac_1952
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Csac_1952
Exosome [BR:csc04147]
 Exosomal proteins
  Proteins found in most exosomes
   Csac_1952
  Exosomal proteins of colorectal cancer cells
   Csac_1952
  Exosomal proteins of bladder cancer cells
   Csac_1952
  Exosomal proteins of melanoma cells
   Csac_1952
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGK TIM DREPP SIS_2
Motif
Other DBs
NCBI-ProteinID: ABP67537
JGI: Csac_1952
UniProt: A4XKV2
Position
complement(2095188..2097140)
Genome map
AA seq 650 aa AA seqDB search
MPRLNKKTIRDIDVSGKKVLVRVDFNVPQDENGNITDDRRIREALPTIKYLIDHNAKVIL
VSHLGRPKGKFDPKYSMAPVAKRLSELLSKEVILAKDVIGEDAKKCVEQMKEKDVVLLEN
VRFHKEEEENDREFAKALASLADIYVNDAFGTAHRAHASTAGVAEFLPAVAGFLMEKEIE
MLGNALANPQRPFVAILGGAKVSDKIGVITNLLEKVDSLLIGGAMAYTFLKAKGYKIGKS
KCEDDKLDIAREIMKKAEEKGVNLLLPVGSIVAKEFKNDTEYMYVPSDAMPDDMMGMDIG
NTTIELFSKEIKKAKTIVWNGPMGVFEFPNFAKGTEAIARAVAEAVEENGAIAIIGGGDS
AAAVEKLGFADKMTHISTGGGASLEFLEGKVLPGIACLLDKNPRKKIIAANWKMNKTPAE
AKEFVEELKKYIDDVQAEVVICAPSILVPYVKEAIEGTNIKLGTQNMFYEEKGAYTGEIS
GPMLKAVGVEYVVIGHSERRQYFGETDEIVNKKVLAALKFGIKPIVCVGETLKQREYGIT
DELVRLQVKIALNGVSREDVEKVVIAYEPIWAIGTGKNATPEEANRVIGVIRNVIAEMYD
EDTAQKVRIQYGGSVNSTNSAEIFNMPEIDGGLVGGASLNAQEFAKILHY
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgccaagattgaacaagaaaacaatccgtgatatagatgtaagtggtaaaaaagtttta
gtgagagttgattttaacgttccgcaagacgaaaatggaaatatcacagatgatagaagg
atcagagaagctcttccaaccattaaatatttgattgaccacaatgcaaaagtaatactt
gtttcacacttaggaaggccaaagggcaagtttgatccaaaatattctatggcacctgtt
gcaaaaaggttatctgagcttcttagcaaggaagtaatattggcaaaagatgttataggc
gaagatgcaaaaaaatgtgttgaacagatgaaagaaaaggatgttgtattgcttgaaaat
gtcagattccacaaagaggaagaagaaaatgacagagaatttgcaaaggctttagcatcg
cttgcagacatttatgtaaatgatgcatttggtacagctcacagagctcatgcatcaaca
gcaggtgttgcagagttcttaccagcagttgctggatttttgatggaaaaagagatagaa
atgcttggcaatgctcttgcaaatcctcaaagaccttttgttgcaatcttaggtggcgca
aaggtttctgataaaattggggttattacaaatcttctcgaaaaggttgatagtctctta
attggcggtgcaatggcatataccttcttgaaggcgaaaggatataaaattgggaagtca
aaatgtgaggatgacaagcttgacattgcgagagagataatgaaaaaggcagaggaaaag
ggagtaaaccttcttttgccagttggaagcattgttgcaaaagaattcaaaaacgataca
gaatatatgtatgtgccatctgatgcaatgccagacgatatgatgggtatggatatagga
aataccacaattgagcttttctcaaaagagataaagaaggcaaagaccattgtgtggaac
gggccaatgggtgtttttgaatttccaaactttgcaaagggaacagaagctattgcaaga
gctgttgctgaggctgttgaagagaatggtgcaattgcaattatcggcggtggagattca
gctgctgctgttgaaaagcttggttttgcagataagatgacacatatctcaacaggtggc
ggagcttcattagagttcttagaaggcaaagttttgcctggtattgcgtgcctgcttgac
aaaaatccgagaaaaaagataatcgcagcaaactggaagatgaacaaaacccctgcagag
gcaaaagaatttgttgaagagctgaaaaagtatattgatgatgtacaagcagaagtagtc
atctgtgctccgtcaattcttgttccttatgtcaaagaagcgatagaagggacaaatata
aaacttggaacacaaaacatgttctatgaagaaaaaggcgcatatacaggtgagatatca
ggtccaatgctcaaagccgttggagtagagtatgtggtaataggccactctgaaagaaga
cagtactttggcgaaacagacgaaatcgtgaacaaaaaagttttagcagcgctgaaattt
gggataaaacctattgtatgcgtcggtgagactttaaagcaaagagaatatggcattaca
gatgagcttgtaagacttcaggtcaagattgcactaaatggtgtttctagagaagatgtt
gagaaagttgtcattgcatatgaacctatctgggcaataggcacaggaaagaatgcaaca
cctgaagaggcaaacagggtaattggtgtaatcagaaatgtaattgctgagatgtatgat
gaagacacagctcagaaagtgagaattcaatatggtggtagtgtaaactctacaaattca
gcagagatatttaacatgccagagattgatggaggcttggttggtggagcaagtttgaac
gctcaggaatttgcaaagatattgcactactaa

DBGET integrated database retrieval system