KEGG   Caldicellulosiruptor saccharolyticus: Csac_2025Help
Entry
Csac_2025         CDS       T00506                                 

Definition
(GenBank) Histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
csc  Caldicellulosiruptor saccharolyticus
Pathway
csc00340  Histidine metabolism
csc01100  Metabolic pathways
csc01110  Biosynthesis of secondary metabolites
csc01230  Biosynthesis of amino acids
Module
csc_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:csc00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Csac_2025
Enzymes [BR:csc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Csac_2025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh LppA
Motif
Other DBs
NCBI-ProteinID: ABP67610
JGI: Csac_2025
UniProt: A4XL25
Position
complement(2168975..2170294)
Genome map
AA seq 439 aa AA seqDB search
MFGKDDIAVKILKGKRELEQFLSNLDSIGYQTVEEIEDKVKRIIADVKLKKDEAILNYTR
LFDCKEFDLEDLIVKEEEIDRAFFECQKEDNKFVQALELAYENIYQYHLKQKEETWLFTK
GDTILGQIVRPLERVGIYVPGGNGSYPSTVLMNSIPAKVAGVKEIIMVTPPDKEKKINKY
TLAAAKICGVNKIFKVGGAQAIAALAFGTELIPKVEKIVGPGNIYVAIAKKILFGNVDID
SIAGPSEVLIIADSFANPKYVAADLLSQAEHDAMARCILITTSQDLALEVNKKVDEMLKA
NPNQIAAQSIERNGVIIIVEDLDDAVEIANRICPEHLELCCKNSEDLIFKIKNAGAIFVG
EFSPEPIGDYIAGPNHVLPTSGTARFFSPLGVYDFVKRISLIKYSKEQFLKDAPFAIEIA
QKEGFLFHANSLKVRLEDV
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
ttgtttggaaaggatgatattgcagtgaagatactaaaaggcaaaagagaattggagcaa
tttttaagcaatttagattctattggttatcagactgttgaagaaatagaagataaagtc
aaaagaataattgctgatgtaaagttaaaaaaagatgaagctattttgaattatacaaga
ctttttgactgcaaagaatttgatcttgaggatttgattgtaaaagaagaagaaattgat
agggctttttttgaatgccaaaaagaggataataaatttgtgcaagctttagaattggct
tatgaaaatatttatcaatatcacttgaaacaaaaagaagagacttggctttttaccaaa
ggtgatacaatcttgggtcagatagtgcggccgttagaaagagttggaatttatgtacca
ggtggtaatggttcatacccttcaaccgttttgatgaattctattcctgcaaaggtagca
ggtgtaaaggaaataattatggtaactcctccagacaaagaaaagaagataaataaatat
accttggcagctgccaagatatgtggagtaaacaaaatttttaaagttggaggagcacaa
gcaattgctgcgcttgcatttgggacagagctgattccaaaagtcgaaaagattgttggg
ccaggaaacatttatgttgctattgctaaaaaaatcttgtttggaaatgtggacattgac
tccattgcaggtccgagtgaggttttgattattgcagacagctttgcaaaccccaaatat
gtggcagctgatttactatctcaggcagaacatgacgcaatggcaagatgtattttaata
acaacttctcaagaccttgcccttgaggtaaataaaaaagtagatgaaatgttaaaagca
aatccaaaccaaatagctgctcagtctattgaaagaaatggtgtaataataatagttgag
gatttagatgatgctgttgagattgcaaataggatttgccctgaacaccttgagctttgt
tgcaaaaattcagaagatttaatctttaaaataaagaatgcaggggcaatctttgttgga
gaattttcaccagagccaattggcgactatattgcaggaccaaatcatgtgttgcctaca
tctggtactgcccgatttttctcgcctcttggcgtttatgattttgtcaagagaattagt
ttgataaaatattcgaaagaacaatttttaaaggatgcaccatttgcaattgagattgca
caaaaggaagggtttttattccacgcaaactctttgaaagtgaggttagaagatgtttag

DBGET integrated database retrieval system