KEGG   Caldicellulosiruptor saccharolyticus: Csac_2231Help
Entry
Csac_2231         CDS       T00506                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
csc  Caldicellulosiruptor saccharolyticus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:csc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Csac_2231
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Csac_2231
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Csac_2231
Enzymes [BR:csc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Csac_2231
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2362094..2363269)
Genome map
AA seq 391 aa AA seqDB search
MDRYFGRFGGMYAPETLMPALLEIEKEFVRLIEDENFKSEYEFYLKNYVGRPSPLYWAKN
LSKHLGVKIYLKREDLNHTGAHKINNCIGQALLAKHMGKKRLIAETGAGQHGVATATVAA
LFGMECEIFMGEEDAKRQYHNVQRMKMLGSSVRVVDKGSKTLKDAINEAMRDWSETYDYT
FYLFGTAAGPHPFPRIVKYFQSVIGNETKKQILEQEGRLPDYVFACVGGGSNAIGIFSAF
LDEPEVKLIGVEGAGEGVNTGKTAATLCSGSVGILHGAKTYVLQDEDGQILNTHSISAGL
DYPGVGPEHAYLKEIGRVEYVGIEDEKAVEAFLLLCKLEGIIPALESSHAIAEVVKRAKN
GMFKKDDVVVINLSGRGDKDIATILQFWRED
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggataggtattttggcaggtttggtggcatgtatgcaccagaaacattgatgccggct
cttttagaaatagaaaaagagtttgtgagactaatcgaagatgaaaattttaaatctgaa
tatgagttttatctcaaaaattatgtgggaagaccatctcccctatactgggccaaaaat
ttgagtaaacaccttggtgtcaagatatacctaaaaagagaagatctgaaccacacaggt
gctcataagataaacaactgtataggccaggcacttttagcaaagcacatgggcaaaaaa
agactcattgccgaaacaggtgcaggtcaacacggtgttgcaacagctacagttgcagca
ctttttggcatggaatgtgagatattcatgggcgaagaggatgcaaaaaggcagtatcat
aatgtgcagagaatgaaaatgcttggcagcagtgtcagagtagttgacaaaggtagcaaa
acactaaaagatgctataaacgaagcaatgcgcgactggagtgagacatatgattacact
ttttatctttttggtaccgctgcgggcccacatccttttccaaggatagtaaagtatttt
caaagtgttattggcaatgagacaaaaaagcaaattttagaacaggagggaagacttcct
gactatgtttttgcatgtgtgggtggtggatcaaacgcaataggtattttttcagccttt
ttagatgagcctgaggtaaagctgataggtgttgaaggtgcaggtgaaggtgtgaatacc
ggaaagactgctgcaacactttgcagtggctctgttggcatccttcatggtgcaaagacg
tatgtactgcaggatgaagatggccagattttaaatacacactcaatttcagcagggctt
gactatccaggggttggtcctgaacacgcttacttaaaagagataggaagagttgagtat
gtggggatagaagatgaaaaggcagtagaggcatttttgcttttgtgtaagttggaagga
attatcccagccttagagagctctcatgctattgcagaggttgtaaaaagggcaaagaat
ggtatgttcaaaaaagacgatgtggttgttataaatctttctggaagaggagataaggat
attgctactattttacagttttggagggaagattaa

DBGET integrated database retrieval system