KEGG   Caldicellulosiruptor saccharolyticus: Csac_2248Help
Entry
Csac_2248         CDS       T00506                                 

Definition
(GenBank) pyruvate flavodoxin/ferredoxin oxidoreductase domain protein
  KO
K00169  
pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
csc  Caldicellulosiruptor saccharolyticus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:csc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Csac_2248
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Csac_2248
   00020 Citrate cycle (TCA cycle)
    Csac_2248
   00620 Pyruvate metabolism
    Csac_2248
   00640 Propanoate metabolism
    Csac_2248
   00650 Butanoate metabolism
    Csac_2248
  Energy metabolism
   00680 Methane metabolism
    Csac_2248
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Csac_2248
Enzymes [BR:csc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Csac_2248
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2380413..2382620)
Genome map
AA seq 735 aa AA seqDB search
MIKPQETIFESGNEMAALAASQINYHIMGYYPITPSTQIAEELDQMRADGQHDILLIAAD
GEHGAAGICYGASLGGGRVFNATSANGLMYALEQLPVQSGTRFPMVLNLVTRSISGPLDI
KGDHSDLMFTLNTGWIILLAKDPQRVYDMNIMAVKISEHPEVNLPVIVAYDGFFTSHQKR
VVSYFKNKEDVLEFVGKTPPPRIVATDPENPVTIGPYMNEPDLINNKYQLSKAMDKAYEV
IPQVFDEFYEISGRKYTLVEGYKMEDAEVAIFVLNSSYDTVCEAVDLLRQKGLKVGVATT
NVLRPWPKKEIQELLKNVKYLTVLDRQESYGAKGGNMTIEVKATLQELRADIKVISRIYG
LGGKDFFLDDAISIFEDLYLAYEGKKQISDFDYIGAYAGDENYKPKKYMEPIKAEWTKNI
ALNTRDLTAMPKRIVPGHGACPGCGIFPNLNLLLKGIEGDVVLLFHTGCGMVVTTAYPQT
AFRTTYIHNLFQNGAATLSGLVEMYHQRQKRGEIPNRELTFILVTGDGGNDIGMGPTIGA
ALRNHKMIIFEYDNGGYMNTGYQLSYTTPYGASSSTSHVGKTQFGKSTFHKDTPQIMAAT
NIPYVATVAESDPIDFVKKARKAQKIMREEGLVYIKALSACPLNWGDEPSKERRVIKAAV
DCCFHPLYEVDHGKTIITYDPEKKGKKIPVIEWLSMMGRTRHLTRPEYKHIIDEFQKEID
RRWERLKAKHEHPLL
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atgataaaacctcaagaaacaatttttgaaagcggaaatgaaatggcggctttggctgca
tcgcagataaattatcatatcatgggatattaccctataacgccatcaacccaaattgca
gaagaacttgaccagatgagagcagatggtcagcatgatatcttgcttattgcagcagat
ggcgagcatggggcagcaggaatttgctacggtgcaagtttaggcggtggaagagttttt
aatgcaacaagtgccaatggtcttatgtatgcattagagcagctgcctgttcaatctggt
acaagatttccaatggttttgaatttagtcacaaggtcaatttctggacctttagatata
aaaggtgatcatagtgacctgatgtttacattaaatactgggtggataatcttgctggca
aaagatcctcaaagggtttatgacatgaatatcatggcagtaaagattagcgaacatcct
gaggttaatttgcctgttattgttgcgtatgatggattttttacaagtcatcaaaaaaga
gttgtaagttattttaagaacaaagaagatgttctggagtttgtaggcaaaactccacca
ccacggattgttgcaacagaccctgaaaatcctgtgacaattggtccatacatgaatgaa
cctgaccttataaataacaaatatcaacttagcaaggcgatggacaaagcttatgaggtc
atccctcaggtatttgatgaattttatgaaataagtggtagaaaatatactttggttgaa
ggttacaaaatggaagatgctgaggttgcaatattcgtgttgaattccagttatgatact
gtttgcgaagctgttgaccttttaaggcagaagggtctcaaagttggtgtggcaacaacg
aacgtgttgcggccctggcctaaaaaagaaatccaagagctgctcaaaaatgtaaaatac
cttactgtattagatagacaagaaagttatggtgcaaaaggtggcaatatgacaattgag
gtaaaagctactctacaagagttaagggcagatataaaagtaattagcaggatttatgga
cttggtggcaaagacttctttttagatgatgccatttctatttttgaagatttgtattta
gcatacgagggtaaaaaacagatatcagattttgattatatcggagcatatgcaggagat
gagaactataagcccaaaaaatacatggagccaataaaggctgagtggacaaaaaatatt
gcattaaatactcgcgacttgacagcaatgcccaaacgaattgttcctgggcatggggca
tgtccaggatgtggaatctttccaaacttgaatctccttttaaaaggtattgaaggggat
gtagttttactttttcatacaggctgtggtatggttgtaacaactgcttatcctcaaaca
gcatttagaacaacttatatccacaatctatttcaaaatggggctgctactttatcggga
cttgtagaaatgtatcatcaacgtcagaaaagaggggagatacccaatagagagttaact
ttcatacttgtaacaggtgatggcgggaacgacataggtatggggccaacaattggagct
gctctgagaaatcacaagatgattatatttgaatacgacaatggtggatatatgaatact
ggttatcaactttcatatacaactccctatggagcctcaagttcaacttcacatgttggc
aaaactcagtttggaaagtcaacattccataaagataccccacagataatggctgcaaca
aatattccatacgtggctactgttgctgagtcagatcccatagattttgtaaaaaaagca
agaaaggcacaaaagattatgagagaagagggacttgtttacattaaagctctgtcagca
tgtccactgaactggggagatgaaccatctaaagaaagaagagtaattaaagcagctgtt
gattgttgtttccatccactttacgaagttgatcatggcaaaactattatcacttatgac
cctgagaaaaaagggaaaaagattcctgttattgagtggttatctatgatgggaagaaca
aggcatcttacaagacctgaatataaacatattatagacgaattccaaaaagaaattgac
agaagatgggaaaggctcaaggcaaaacatgaacacccccttctatag

DBGET integrated database retrieval system