KEGG   Caldicellulosiruptor saccharolyticus: Csac_2353Help
Entry
Csac_2353         CDS       T00506                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
csc  Caldicellulosiruptor saccharolyticus
Pathway
csc00900  Terpenoid backbone biosynthesis
csc01100  Metabolic pathways
csc01110  Biosynthesis of secondary metabolites
csc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:csc00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Csac_2353
Enzymes [BR:csc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Csac_2353
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXPR_C DXP_redisom_C DXP_reductoisom Epimerase
Motif
Other DBs
NCBI-ProteinID: ABP67931
JGI: Csac_2353
UniProt: A4XLZ6
Position
complement(2469446..2470612)
Genome map
AA seq 388 aa AA seqDB search
MTKRICILGSTGSIGCQAVDVAKRLGIKVVGLSAYQNIGMLISQAKDLNPEILCIGDERY
YSILKEQFPNKIVVAGQKGLIELATYENADLIVNALVGISGLVPTIEAIKAGKKVALANK
ETLVVGGKIIKQMIKDKSNENQDYILIPVDSEHSAIFQCLVGEDKRDVRRIILTASGGPF
RGKKLDQLKNVKIEDVLSHPTWRMGKKITVDSATLINKGFEVIEAMFFFDKKTDEIDVVI
HPQSIIHSMVEFVDGSIKAQISNPDMRLSIEYSLTYPKRSICLIEPLDFSKLKQLTFEEP
DFETFFLLKLAYDCAQKGESYPVVLNAADEEAVKIFLEGKITFVDMMNYVAKVVENHRPQ
QINSIEDILEVDKIARMELKKIVEGEMS
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaagaatttgcatcttagggtcaactggttcaattggatgtcaagcagtagat
gttgcaaagaggttaggaataaaggtggtaggactttctgcatatcagaatattggaatg
ctcatatcccaagcaaaggatctgaaccctgagattctttgcataggtgatgagaggtat
tattctattttaaaagagcaatttcctaataaaatagttgtagcaggtcaaaaaggactg
attgagcttgcaacttatgaaaatgctgaccttattgtaaatgcattagtgggaatatcg
gggttagttccaaccattgaagcaataaaagcaggtaaaaaggttgcacttgccaacaaa
gagacgttagttgtcggtggaaaaattataaaacaaatgatcaaggacaaatcaaatgaa
aaccaagactacattttgattcctgttgactcggagcacagtgcaatctttcagtgtctt
gtgggtgaggataaaagggatgtcagaagaataatattgacagcctcaggcggaccattt
agaggtaaaaaattagaccaactaaaaaatgtcaaaatagaagatgtgctttcgcatcct
acatggagaatgggaaaaaaaataacagttgattctgcaacgctaattaacaaaggtttt
gaagttattgaagcaatgtttttctttgacaaaaaaactgatgagattgatgttgtaata
catccccaaagtattatacattcaatggtggagtttgttgatggctctataaaagctcag
atttcaaatccagatatgcgactttcaattgaatacagtttaacgtatcccaaaaggagt
atctgcttaatagagcctcttgactttagcaaattaaagcagcttacattcgaagagcct
gattttgagacattctttttactcaagctcgcatacgattgtgcacaaaaaggggaaagt
tatccagttgttttaaacgcggctgacgaagaagcagttaaaattttcttggaggggaag
ataacatttgttgatatgatgaattatgtagcaaaggttgttgagaaccacaggccacaa
caaatcaattcaattgaggacatcttagaggttgataaaatagcaaggatggaactcaaa
aaaatagtggaaggtgagatgtcttga

DBGET integrated database retrieval system