KEGG   Caldicellulosiruptor saccharolyticus: Csac_2366Help
Entry
Csac_2366         CDS       T00506                                 

Definition
(GenBank) phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
csc  Caldicellulosiruptor saccharolyticus
Pathway
csc00010  Glycolysis / Gluconeogenesis
csc00030  Pentose phosphate pathway
csc00051  Fructose and mannose metabolism
csc00052  Galactose metabolism
csc00680  Methane metabolism
csc01100  Metabolic pathways
csc01110  Biosynthesis of secondary metabolites
csc01120  Microbial metabolism in diverse environments
csc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:csc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Csac_2366
   00030 Pentose phosphate pathway
    Csac_2366
   00051 Fructose and mannose metabolism
    Csac_2366
   00052 Galactose metabolism
    Csac_2366
  Energy metabolism
   00680 Methane metabolism
    Csac_2366
Enzymes [BR:csc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Csac_2366
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Csac_2366
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: ABP67944
JGI: Csac_2366
UniProt: A4XM09
Position
2482309..2483556
Genome map
AA seq 415 aa AA seqDB search
MPKEGNCVIAQSGGPTAVINASLLGVIEEAMKQHPIRAIYGAKNGIIGLIDEELYDLRME
DPEELKLLKTTPSSALGSCRYQLKPFEHDEKDYVKIFNVFEAHNIRYFFYIGGNDSMDTA
DKLTRYAKKIGYDICIIGIPKTIDNDLVMTDHCPGFGSAAKYIATSVMEIARDAVVYPTN
IVTIIEVMGRNAGWLAAASALAAKDIGAPDLIYLPEVPFSVDKFLDDVRNIHKKTGKITI
VVSEGIKDKDGKYIADMSHKFGIDAFGHVQLGGAAFVLENIIREEVEKRVKAIQFNVLQR
SAAHIMSKTDVEEAYMVGRMAVKYAVEGASGYMVAIKRDSDSPYSSSTELVELYKVANAE
KLVPLAWISHDGNYVKEEILNYIQPLIEGEVEIKFEKGLPRYAKLRKIMVPKKVV
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaagagggaaattgtgtaatagcgcaatcggggggaccaactgctgttatcaat
gcctcgcttttaggtgtaattgaagaagcgatgaagcaacatccaataagggctatttat
ggtgcaaaaaatgggataattggtcttattgatgaggaactctacgacctcagaatggag
gaccctgaagaattaaagcttttaaaaactacaccttcatcggccttgggttcttgtcga
tatcagctaaagccttttgagcacgatgaaaaagactatgttaagatttttaatgttttt
gaagcacacaatataaggtatttcttttacattggtggaaatgattcaatggatactgct
gacaagcttacacgctatgcaaaaaagattggttatgatatatgcataataggaattccg
aagacaattgacaacgaccttgtcatgacagaccactgccctggctttggtagtgctgca
aagtacattgcaacgtctgtcatggaaatagcaagagatgctgttgtatatccaacaaat
attgttacaataattgaagtaatgggaagaaatgccgggtggcttgctgctgcatcagcc
ttggctgcgaaagatattggtgcacctgaccttatttacctacctgaagtaccgttttct
gttgacaagttcttagatgatgtcagaaatatacacaagaagacaggaaaaattacaatt
gtagtatcagagggtatcaaggacaaagatggaaagtacattgctgatatgagccacaag
tttggaatagacgcatttgggcatgtacaacttggtggtgcagcgtttgttttagaaaac
ataatccgtgaagaagtggaaaagagagtaaaagcaatccagttcaatgttctgcagaga
agtgcagctcatatcatgtcaaagactgacgttgaagaggcatacatggttggaagaatg
gctgtaaagtatgcagttgaaggtgcaagtggatacatggttgcaattaagcgtgacagt
gatagtccatattccagttcaacagaacttgtagaactttataaagttgcaaacgcagag
aaattagtacctcttgcatggatttctcatgatggaaactatgtaaaagaagaaattctc
aattatatccagcctctaatcgaaggcgaggttgaaatcaaatttgaaaagggacttcct
cgatatgcaaagctcagaaagataatggtgccaaaaaaggttgtctaa

DBGET integrated database retrieval system