KEGG   Caldicellulosiruptor saccharolyticus: Csac_2366Help
Entry
Csac_2366         CDS       T00506                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
csc  Caldicellulosiruptor saccharolyticus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:csc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Csac_2366
   01230 Biosynthesis of amino acids
    Csac_2366
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Csac_2366
   00030 Pentose phosphate pathway
    Csac_2366
   00051 Fructose and mannose metabolism
    Csac_2366
   00052 Galactose metabolism
    Csac_2366
  Energy metabolism
   00680 Methane metabolism
    Csac_2366
Enzymes [BR:csc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Csac_2366
Protein phosphatases and associated proteins [BR:csc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Csac_2366
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2482309..2483556
Genome map
AA seq 415 aa AA seqDB search
MPKEGNCVIAQSGGPTAVINASLLGVIEEAMKQHPIRAIYGAKNGIIGLIDEELYDLRME
DPEELKLLKTTPSSALGSCRYQLKPFEHDEKDYVKIFNVFEAHNIRYFFYIGGNDSMDTA
DKLTRYAKKIGYDICIIGIPKTIDNDLVMTDHCPGFGSAAKYIATSVMEIARDAVVYPTN
IVTIIEVMGRNAGWLAAASALAAKDIGAPDLIYLPEVPFSVDKFLDDVRNIHKKTGKITI
VVSEGIKDKDGKYIADMSHKFGIDAFGHVQLGGAAFVLENIIREEVEKRVKAIQFNVLQR
SAAHIMSKTDVEEAYMVGRMAVKYAVEGASGYMVAIKRDSDSPYSSSTELVELYKVANAE
KLVPLAWISHDGNYVKEEILNYIQPLIEGEVEIKFEKGLPRYAKLRKIMVPKKVV
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaagagggaaattgtgtaatagcgcaatcggggggaccaactgctgttatcaat
gcctcgcttttaggtgtaattgaagaagcgatgaagcaacatccaataagggctatttat
ggtgcaaaaaatgggataattggtcttattgatgaggaactctacgacctcagaatggag
gaccctgaagaattaaagcttttaaaaactacaccttcatcggccttgggttcttgtcga
tatcagctaaagccttttgagcacgatgaaaaagactatgttaagatttttaatgttttt
gaagcacacaatataaggtatttcttttacattggtggaaatgattcaatggatactgct
gacaagcttacacgctatgcaaaaaagattggttatgatatatgcataataggaattccg
aagacaattgacaacgaccttgtcatgacagaccactgccctggctttggtagtgctgca
aagtacattgcaacgtctgtcatggaaatagcaagagatgctgttgtatatccaacaaat
attgttacaataattgaagtaatgggaagaaatgccgggtggcttgctgctgcatcagcc
ttggctgcgaaagatattggtgcacctgaccttatttacctacctgaagtaccgttttct
gttgacaagttcttagatgatgtcagaaatatacacaagaagacaggaaaaattacaatt
gtagtatcagagggtatcaaggacaaagatggaaagtacattgctgatatgagccacaag
tttggaatagacgcatttgggcatgtacaacttggtggtgcagcgtttgttttagaaaac
ataatccgtgaagaagtggaaaagagagtaaaagcaatccagttcaatgttctgcagaga
agtgcagctcatatcatgtcaaagactgacgttgaagaggcatacatggttggaagaatg
gctgtaaagtatgcagttgaaggtgcaagtggatacatggttgcaattaagcgtgacagt
gatagtccatattccagttcaacagaacttgtagaactttataaagttgcaaacgcagag
aaattagtacctcttgcatggatttctcatgatggaaactatgtaaaagaagaaattctc
aattatatccagcctctaatcgaaggcgaggttgaaatcaaatttgaaaagggacttcct
cgatatgcaaagctcagaaagataatggtgccaaaaaaggttgtctaa

DBGET integrated database retrieval system