KEGG   Caldicellulosiruptor saccharolyticus: Csac_2405Help
Entry
Csac_2405         CDS       T00506                                 

Definition
endo-1,4-beta-xylanase (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
csc  Caldicellulosiruptor saccharolyticus
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2538851..2539789)
Genome map
AA seq 312 aa AA seqDB search
MKQQYLLDYEATKASKNGMPVCKFDSCIPALQFCKENGIKMRGHVLVWHNQTPEWFFHKD
YDVSKPLVDAATMERRLESYIKQVIEFCQKNYPGVVYCWDVVNEAILDDGSWREINNNWY
TIMKEKYVEKAFYYARKYAKKDVALFYNDYNVFLPAKREAIYNLAQKLKEKGLIDGLGLQ
PTVGLNYPELDSDDIDSFKTTLETFAKLGLQIHITELNFEIKGDESNRTPENLKKQADRY
YEMMKLLLKEDTDNGGPCNITCVTVFGICDDYPLYKNFKQCMYLWDKNCNPKPCFYSFLQ
AGLDWKASLLSK
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaacaataccttttagattatgaagctacaaaagcaagtaaaaatggaatgcca
gtgtgtaaatttgacagctgcattcctgctttacaattttgtaaggaaaatggcataaaa
atgagaggacatgtgttagtatggcataatcagacaccagaatggtttttccacaaagac
tatgatgtatcgaaaccacttgtagatgctgctactatggaacgccggttggaaagttat
atcaaacaggtaattgaattttgtcaaaaaaattatcccggtgtagtctattgctgggat
gttgttaacgaagctatacttgatgatggttcatggagagaaatcaataataattggtat
accattatgaaagaaaagtatgtggaaaaggcattttattatgcaagaaaatatgccaaa
aaagatgttgccctgttttacaatgattacaatgtttttctccctgcaaagagagaagca
atttataatcttgctcagaaacttaaagaaaaaggattgattgacgggttgggtcttcaa
cctacagtaggcttgaattatcctgaattagattctgatgatatagattcattcaaaacg
acattagaaacatttgcaaaacttggcttacaaattcatattactgagttaaattttgaa
ataaagggagatgagagcaatcgtactcctgaaaatctcaaaaaacaagcagataggtat
tacgaaatgatgaagttattattgaaggaagatactgataatggtgggccttgcaacata
acttgtgttactgtttttggtatctgtgacgattatccactatataaaaattttaagcag
tgcatgtatctttgggataaaaattgcaatcctaaaccatgtttttattcatttctccaa
gcaggtttagactggaaagcatctttattaagcaaataa

DBGET integrated database retrieval system