KEGG   Caldicellulosiruptor saccharolyticus: Csac_2513Help
Entry
Csac_2513         CDS       T00506                                 

Definition
(GenBank) Glucosylceramidase
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
csc  Caldicellulosiruptor saccharolyticus
Pathway
csc00511  Other glycan degradation
csc00600  Sphingolipid metabolism
csc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csc00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Csac_2513
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Csac_2513
Enzymes [BR:csc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Csac_2513
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C Melibiase Thionin
Motif
Other DBs
NCBI-ProteinID: ABP68090
JGI: Csac_2513
UniProt: A4XMF5
Position
complement(2661888..2663225)
Genome map
AA seq 445 aa AA seqDB search
MFKKIACYITAKQGTFMQQVDNIKECDKLTSESVITIDPSTTFQKVIGFGGALTEAAAVN
ILSLLPHQQDEILRGYFDPEKGLGYKLCRIHMNSCDFCISTYSCDDVEGDVELKHFNIER
DKKMVIPLLKRIMKYCPDLKILVSPWSPPAWMKTNNDMCHGGKLKDEYKKTWARFFCKFI
KAYQEEGIDIWAVTVQNEPMATQVWESCIYTAEEERDFVKDCLGPTLEEEGLSHIKILIW
DHNKDIIYERVKTILSDKEAAKFVWGVAFHWYGGDHFDQLKKIKEEFPDVNLVFTEGCQE
GGVKLGSWELGERYAHEIIGDFNNYTIGFMDWNIVLDTVGGPNHVGNFCDAPIIVDKDQK
KIYYQNAYYYIGHFSKFIKPGAKIVKSSCSSSRLEVLAAKNGDDTLAVVVLNKNPEEIEF
NMVIENKIFCGNSPARSISTVVLER
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaaaaaattgcatgttacataacagcaaagcaaggcactttcatgcaacaagtt
gacaatataaaagaatgcgacaaattaacaagtgagtctgttataacaattgatccatcc
actacatttcaaaaggtaataggctttggtggggcactgactgaagctgctgcggtaaat
atactatcacttttgccacaccagcaagatgagattttaagaggttactttgaccctgaa
aaggggcttggctacaaactctgtagaatccacatgaacagctgtgatttttgtataagt
acctacagctgtgatgatgttgagggcgatgttgagctaaaacattttaacattgaaaga
gacaagaagatggttataccacttttgaagaggataatgaaatactgtcctgatttaaag
attttagtgtcgccatggagcccacctgcttggatgaagacaaataacgatatgtgccat
ggtggcaagttgaaagatgagtataaaaaaacatgggcaaggtttttctgtaagtttata
aaggcttatcaagaggaagggattgatatatgggcagtgacagttcaaaatgaaccaatg
gcaactcaagtgtgggagtcgtgcatatacacagctgaagaggaaagagattttgtgaag
gattgcttaggaccaactcttgaagaagaagggctttcccatataaaaatacttatatgg
gaccacaacaaagatatcatatatgagagggtaaagacaattttgagtgacaaagaagct
gcaaaatttgtatggggagttgcattccactggtatggaggagaccattttgaccagctc
aaaaaaataaaagaagagtttcctgatgtgaatttggtgtttaccgaaggttgtcaggaa
ggtggagtaaagcttggttcttgggagcttggagaaaggtatgctcatgagataattggt
gattttaataactacacaattggatttatggattggaatattgttcttgacacagttgga
ggccccaatcatgttggaaacttttgtgacgcaccgataattgttgataaagaccagaaa
aagatttattatcaaaatgcgtattattatataggacatttttctaaattcataaagccg
ggtgctaaaatagtcaaaagcagctgcagtagttcaagacttgaggttttggcagcaaag
aatggggatgatactttggcggtggttgtgctaaataaaaacccagaggaaatagagttt
aatatggtcattgaaaataaaatattctgtggaaactccccagcaaggtctatatcaact
gttgttttggaaaggtaa

DBGET integrated database retrieval system