KEGG   Caldicellulosiruptor saccharolyticus: Csac_2767Help
Entry
Csac_2767         CDS       T00506                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
csc  Caldicellulosiruptor saccharolyticus
Pathway
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:csc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Csac_2767
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Csac_2767
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Csac_2767
Enzymes [BR:csc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Csac_2767
Exosome [BR:csc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Csac_2767
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2956756..2958399
Genome map
AA seq 547 aa AA seqDB search
MKKFFKSKKASIISLLLILCLVFSTLVFASQDSNKQSNKVKNVILMIPDGMTIAHTTLAR
WYQGGEPLSMDEIACGLVRTYSANNPITDSAPAATAYATGYKTQNRYLSIYPEIASMPGV
GQVEEKDFFKPIVTILEAAKKFGKSTGLVVTCQFPHATPAAFAAHTDNRNDYESIAEQMV
YNQVDVVLGGGWKYIDKNQRKDKEDLVQYLRDNGFVVTTKWEDLKNESPRKVWGLFAQDA
MHYEFDRNGTDKPSLAEMTQKALQILSKNKNGFFLMVEGSEIDWASHANDPVGVVSEVLA
FDKAVKVALDFAKSRDDTAVIIAPDHNNGGMTLGNYSAQVDSVLLNDFLKYIKKAKRTGS
GIEDLLGNNRTDENIKKIVSQYYGVDNLTQDEIDAIKKAPAGRLNYVLGPIISKRSYIGW
TTNEHTGEDVVLYAYHPNGYVPHGVIDNTEVCDYIADILGIDLGSFNENSYISNVDLEEK
GYNVTIDTSNPNNIQLVISSKGKTYIVPQNKNAVIEGNKQYTLKYVSAYITSAKRFFVSS
EIEEILK
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattttttaaatctaaaaaggcttctataatctcgttacttcttattctctgc
cttgtttttagcacccttgtctttgcaagccaagacagtaacaaacagtccaacaaagtt
aaaaacgtaatactcatgataccagatggcatgacaatagctcacaccactttggcaaga
tggtatcaaggcggagaacctctttcaatggatgagatagcatgtgggcttgtgagaaca
tactcagcaaacaacccaataactgactcagcaccagctgcaacagcatatgcgacagga
tacaaaacacaaaacagatatctttccatctacccggagattgcttcaatgccaggtgtt
ggccaggttgaagaaaaagacttcttcaaaccaattgtgacaatcttagaagcagcaaaa
aagtttggaaagtcaacaggccttgttgtaacttgtcaatttcctcatgcaacccctgca
gcttttgcagcgcatacagataataggaatgactacgaaagtatagctgaacaaatggtt
tacaatcaggttgatgtggtacttggtggtgggtggaagtatattgacaaaaatcaaaga
aaagacaaagaagatttagttcagtatttaagagataatggatttgttgtaacaaccaag
tgggaagatttgaaaaatgaatcgccaagaaaggtttggggactttttgctcaagatgca
atgcactatgaatttgacagaaatggcacagacaaaccttctttggcagagatgacacaa
aaagcactgcagattttatcaaaaaataaaaatggattcttcttgatggttgaaggaagc
gaaatagactgggcatcacatgcaaatgacccagttggtgttgtctcagaggtgttggca
tttgacaaggcagtaaaagtagccttagattttgcaaaatcaagagatgatacagcagta
ataattgcaccagaccacaacaacggtggaatgaccttaggaaattactcagctcaagta
gattctgttttgctcaatgatttcttaaaatatatcaaaaaagcaaaaagaacaggcagc
ggaattgaagatttgcttggaaacaacagaacagatgagaatatcaaaaaaatagtttca
caatattacggagttgacaatctcactcaagatgaaatagatgcaatcaaaaaggcacca
gcaggaaggcttaattatgttcttggtccaatcatcagcaagcgttcatatatcggctgg
actacaaatgagcacacaggtgaagacgtcgtactttatgcgtatcatccaaacggatac
gttcctcatggtgttatagacaacacagaagtttgtgattatatagctgatattttggga
atagaccttggaagcttcaatgaaaatagttacatctcaaacgtagacttagaagaaaaa
ggttacaatgtgacaattgatacaagcaatccaaataatattcagcttgtgataagcagc
aagggcaagacatatattgtgccacaaaataagaatgcagtaattgaaggaaacaaacaa
tatactctcaaatatgttagtgcgtatattacaagtgcaaagagattctttgtgtcaagt
gagatagaagaaatattgaaatag

DBGET integrated database retrieval system