KEGG   Clostridium stercorarium subsp. stercorarium DSM 8532: Clst_0098Help
Entry
Clst_0098         CDS       T02527                                 

Definition
amylase (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
csd  Clostridium stercorarium subsp. stercorarium DSM 8532
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:csd00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(107277..109502)
Genome map
AA seq 741 aa AA seqDB search
MGYVFDENGIEAVICGFHKNPHEILGMHTQGDETAICAYIPNAKHIEVVFYKSGLSYEMD
KKDDRGFFTVIIPGRPENSMYKFKVTDHTGHRFETYDPYSFLPTISDYDLYLFNEGTHHR
IYEKLGAHIRNINGVSGVSFCVWAPEAKRVSVVGDFNQWDGRRHQMRMLGSSGVWEIFIP
GLVKNDIYKYEIKTPFDEIYLKADPYAFYAEKPPKTASKVYDLHNYEWHDEQWMKQREKE
STFDKPLNIYEVHLGSWMQQPDPDPESETGFKPLSYRQLAEKLVPYVKEMGYTHIELLPV
MEHPYDGSWGYQITGYYAVTARYGIPEDFKYFIDTCHQNGIGVILDWVPVHFPKDGHGLA
RFDGTACYEHEHPLLGEHHQWGTHIFNFSRNEVRSFLISNAIYWFDIFHVDGLRVDAVAF
MLYLDYCRNDGEWIPNRYGGRENLDAIEFLKQLNCAVYKYFPNVLMIAEDSTAWPMVTRP
VHVGGLGFSHKWNMGWMNDFLRYMSMDPIYRKYHHNLITFSFMYAWSENFILVLSHDEVV
HGKCSLLNKMPGDYWQKFAGLRAALGYFIGHPGKKLLFMGGEFGQFIEWKYKESLDWHLL
SYPMHEKLHRYVRELNNLYLNEPALYEVDFHYDGFEWIDCNDTENSIVSFIRKGKDWRDM
LIFVCNFTPVTHENYRIGAPFYTYYEEVFNSDREKYGGSNVINAGKIHSENIPYHHRPYS
LVLRIPPLATIILRPDLKNFR
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atgggttatgtcttcgacgaaaatggaatagaagcggttatatgtgggtttcacaaaaat
ccgcacgaaatattgggtatgcacacacagggtgatgagaccgcaatatgcgcatacata
cccaatgcaaagcatattgaagttgtcttctacaaaagcggattatcctatgaaatggac
aagaaggacgatcgggggttctttacagtaataattcccggtcgtcctgaaaattcaatg
tataagttcaaagtcaccgatcatacaggtcatcgttttgaaacttacgatccttattcc
tttttgcctacgatatccgattatgatttatatctcttcaacgaaggcacccatcacagg
atctatgaaaaattaggtgcccatatacgaaatattaacggtgtttcgggggtgtctttc
tgcgtctgggctcctgaagcgaaaagagtcagtgttgtcggcgacttcaaccaatgggac
ggaagaaggcaccagatgagaatgctgggaagttcaggggtttgggaaatatttattccc
gggctggtgaaaaatgatatctataaatatgaaatcaaaacaccgtttgacgaaatttat
cttaaggccgacccctatgcgttttacgcggaaaagccgccgaaaaccgcatccaaggta
tatgatctgcacaattacgaatggcatgacgaacaatggatgaaacaacgtgaaaaagaa
agcacttttgacaagcctttaaatatttatgaggtgcatttgggttcgtggatgcagcag
cccgatcccgatcctgagtccgaaacaggctttaagcctttaagttacagacagttggcc
gaaaaactggttccatacgttaaggaaatgggttatacgcacatagagctgttacctgtt
atggagcatccttatgacggctcatggggatatcagatcacgggatactacgccgtaacg
gcgcgctacggcatacctgaggattttaaatactttattgacacctgtcaccagaacggc
ataggcgtaattctggactgggttcccgtccatttcccgaaagacggacacggacttgcc
aggtttgacggcaccgcgtgctatgagcatgaacatcctctccttggggaacaccatcag
tggggaacgcatattttcaatttttcccggaatgaagtccgaagctttttaatatcgaac
gcgatttactggtttgatattttccacgtcgacgggttaagggtggatgccgttgcgttc
atgctgtacctggattattgccggaacgacggcgaatggattccgaacaggtacggaggc
agggaaaaccttgacgcaatagaatttttaaaacagctaaactgcgccgtatacaaatat
ttcccaaatgtattaatgattgcggaggattccacggcctggccgatggtgacaaggcct
gtgcatgtcggaggccttggcttttcacacaaatggaatatgggctggatgaacgatttt
ctaagatatatgagcatggatccgatataccgcaaataccaccataaccttataaccttt
tcgtttatgtatgcgtggagcgaaaatttcatacttgtgctgtcccatgacgaagtggtg
catggtaagtgttcactgttaaacaaaatgccgggggactactggcagaaatttgcgggt
ctcagggcggcgctgggctatttcatcggccaccctggaaaaaaacttctgtttatggga
ggggagttcggccagtttattgaatggaagtacaaagaaagccttgactggcacctctta
agttacccgatgcatgaaaaactgcacaggtatgtgagggaacttaataatttatatctt
aatgaacccgcattatatgaagtggatttccattatgacggtttcgaatggatagactgc
aatgataccgagaacagcattgtatcctttatccgtaaaggtaaggactggcgggatatg
ctgatcttcgtatgcaacttcacgcccgtaacccatgaaaactatcgcatcggcgcgcct
ttttacacatactacgaggaagttttcaacagcgaccgggaaaaatacggcggaagcaat
gtcataaatgccggtaaaattcattccgaaaacattccctatcaccacaggccatattca
ctcgttctgagaatcccgcctctggcgacaataattttaaggcctgatttaaaaaatttc
agataa

DBGET integrated database retrieval system