KEGG   Clostridium stercorarium subsp. stercorarium DSM 8532: Clst_0423Help
Entry
Clst_0423         CDS       T02527                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
csd  Clostridium stercorarium subsp. stercorarium DSM 8532
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:csd00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:csd00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:csd00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
462210..464408
Genome map
AA seq 732 aa AA seqDB search
MGIKFFEDRKYFKLDARDTSYIIAIVDDEKFLGHVYFGKRIPDEPLDIESLLRINEYPYV
PSKNNRERMSFHDSFPTEYSTHGLGDFRESCLVVKDSNGNSVCGITYCSYKIYKGKPTLK
GLPATFGDENSCTTLEIICSDKVLNLEVTLIYTVFENLDVITRSVRIKNNSDNDVTLEKA
LSACVDFDGIDYDIISLNGSWARERRIQRVPVSFGKRSVESIRGISSHQSNPFIALVDKN
ANEDYGNVYGFNFVYSGNFIAVVEGCQFETTRVVMGIHPANFEWTLAPGEEFIAPEVVMV
YSDSGIGKMTRTFHDLYRNHLIRGKYRDRKRPVLINSWEATYFDFDTEKLLSIAREAAKL
GIEMLVMDDGWFGNRNDDNSSLGDWYVNEKKIKGGLKYLVDEVNKLGLEFGIWFEPEMIS
PDSDLYRAHPDWCIHVPNRTPVLCRNQYVLDLTNDEVVEYVYSRLRDILSSANITYVKWD
MNRQLSDVGSSFMPKEKQGEIMHRYVLAVYKLLDRLTTEFPHILIEGCAGGGGRFDPGIL
YYCPQIWCSDNTDAIERLAIQHGTAMVYPLSTIGAHVSDCPNHIVGRTTPFETRGYVALA
GTFGYELDVTRISEDDRKLIPEQIEMYHKYNDLIRTGDYYRIANYGDNHLYDCWSVVAKD
KSEVLVTYIQVLQRPNSRSRRIKLKGLDENALYRDTETNRLYSGSALMYAGLNITGLHGD
FKGKLIHLVKEK
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgggaattaaattttttgaggatcggaaatatttcaagctggatgcccgggacacttct
tacataatagccattgtggacgacgaaaaatttttagggcatgtatatttcgggaaaaga
attcccgatgaacctttggatattgaatcacttttacgcattaatgaatacccttatgtc
ccgtctaaaaacaacagggaaagaatgtctttccatgattcctttccgaccgaatattcc
actcacgggctgggcgatttcagagaatcctgtcttgttgtaaaggacagtaacggaaat
tcggtatgcggtataacatactgttcttataaaatttacaaagggaaaccgacattaaag
gggttgcctgcgacatttggggacgaaaattcatgcaccacccttgaaatcatatgcagt
gataaggtactgaaccttgaagtaacgctgatttataccgttttcgagaatttggatgtt
ataacaagaagtgtgagaataaaaaataattccgacaatgatgtcacactggaaaaagca
ttgtctgcatgcgtggatttcgacggaattgactatgacataatctccctgaacggatca
tgggccagagagagaagaattcagagggttcctgtaagtttcggcaaaaggtctgtggaa
tcaatcaggggaatatcaagccatcaaagcaacccctttattgcactcgtggataaaaac
gcaaatgaggattacggcaatgtatacggctttaactttgtgtattcgggaaatttcata
gccgttgtggaaggttgccagtttgagacaacccgcgtcgtaatgggtattcaccctgcc
aattttgaatggacactggcaccgggggaagagttcatagctccggaagtggttatggta
tattccgattcgggaataggaaaaatgacaagaaccttccatgacttgtacagaaaccat
cttatacgcggaaaatacagggacagaaaaaggcctgtgcttatcaatagctgggaagcc
acatattttgactttgacacagaaaaactgttatcgatagccagagaagccgcaaagctt
ggaattgaaatgctggttatggatgacggttggtttggcaaccggaacgacgacaacagt
tctttgggcgactggtatgttaacgagaaaaaaatcaaaggcggcttaaaatatttggtt
gacgaagtgaacaaactcgggcttgagtttggcatatggtttgagcccgaaatgatatcc
cctgattcagatctttaccgggcgcatcccgactggtgcattcatgttccaaaccgtaca
cctgtactttgcagaaaccagtacgttttggatcttacaaacgacgaagtggtggaatat
gtatattcaaggctgagggatattctttcctcagcaaacattacctatgtcaaatgggat
atgaaccgacagttgagtgacgtgggaagcagttttatgccaaaggaaaaacagggagaa
ataatgcacagatatgtgctggcggtatataaattattggacaggcttacaaccgaattc
ccgcatatactcatcgaaggctgcgcgggcggtggaggaaggtttgatcccggaatactg
tactactgtccgcaaatttggtgttccgacaatacggatgccattgaacgccttgcaata
cagcacggtacggcaatggtgtatccgctttcaacaataggcgcccatgtgagcgattgc
ccgaaccatatcgttggaaggaccacgcctttcgaaacaagaggatatgtggctcttgca
ggaacgtttggatacgagctggacgtgacaaggatttcggaagatgatagaaagcttata
ccagagcagatagaaatgtatcataagtataatgatcttatcagaacaggagactattac
cgtatagccaattacggagacaaccatctgtatgactgctggtcggttgtggcgaaagat
aagtccgaagtattggttacatatatacaggtattacaaaggccaaattcacggagcaga
agaattaagcttaaaggtcttgacgaaaatgcgctttacagggatacagaaacaaaccgc
ttatacagcggcagcgcactgatgtacgctggtttgaacattacagggctgcatggggat
tttaaaggcaaactcatacatctggtgaaagaaaagtag

DBGET integrated database retrieval system