KEGG   Clostridium stercorarium subsp. stercorarium DSM 8532: Clst_0565Help
Entry
Clst_0565         CDS       T02527                                 

Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
csd  Clostridium stercorarium subsp. stercorarium DSM 8532
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:csd00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
621233..622264
Genome map
AA seq 343 aa AA seqDB search
MRQKLAELTWLDGISGNEQNVRNFIIQNLPDKSLKYYVDNIGNLIVKGRSNGNCNLRVMV
AAHMDEVGFMVNYITDDGKLKFSPVGGVDSRILIGQHVRVGKDKIPGVIGYKSIHLQDKS
ERESVVKIKSLYIDIAAKDRENAQELVSTGDYVAFASEPVFFGDGKIKAKALDDRAGCAV
IMELLKETWPFELYACFTVQEEIGLRGALVAANRVKPDIGIVLEGTTCADVPKVKEHETS
TVMGKGPSISFADRTSLADRELFNHFINTAEKEGIRYQIKNTVSGGNDAGRIQTSGTGVR
TLVVSVPCRYIHSPVSVLDLNDLDNMLKLVSRSLHTLPEALGR
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgagacaaaaacttgccgaacttacatggcttgacggcatatcaggaaatgagcagaac
gtacgcaattttataatacaaaaccttcccgacaaatcgctgaagtattatgtggacaat
atcggaaacctgattgtaaaaggcagaagcaatgggaactgcaatctgagggtaatggtt
gccgcgcatatggacgaagtgggttttatggtcaattatataaccgacgacggaaaactt
aaattttcccccgtcggcggcgtggatagccgtattctgattggtcagcatgtgcgtgtg
ggaaaggataaaattccgggcgtaatcgggtataagtccatccatttgcaggacaaaagc
gaaagggagagcgtcgtaaaaatcaaaagcctttatatagacatagccgcaaaggacagg
gaaaatgcgcaggagcttgtcagcaccggcgattacgtcgcctttgcctcagagcctgtt
tttttcggcgacggaaaaataaaggcgaaggcactggacgacagagcgggatgcgcggta
attatggaacttctgaaggaaacctggccgtttgaattgtatgcgtgttttactgtgcag
gaagaaatagggcttagaggggcacttgtcgcggcaaacagggttaagcccgatatcggc
attgtgcttgagggaacaacctgtgctgacgtcccgaaggtaaaggagcatgaaacgtcg
acggtaatgggaaagggaccgtcaataagctttgccgacaggacttctctggccgacaga
gagctttttaatcactttataaataccgctgaaaaggaaggcattcgatatcagattaaa
aacacggtgtccggcggaaatgacgctggaagaatacagacatcgggtacgggggtcagg
actttggttgtatcggttccgtgtcgttatattcattcgccggtatcggtccttgatttg
aatgatctggacaatatgctgaaactggtaagcaggtctttgcatacattgcctgaagca
ttagggaggtag

DBGET integrated database retrieval system