KEGG   Clostridium stercorarium subsp. stercorarium DSM 8532: Clst_0566Help
Entry
Clst_0566         CDS       T02527                                 

Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
csd  Clostridium stercorarium subsp. stercorarium DSM 8532
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csd00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Clst_0566
Enzymes [BR:csd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Clst_0566
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
622271..623266
Genome map
AA seq 331 aa AA seqDB search
MISLLKELTNAYGPSGREDEIRNVIREKISSRADEVYTDTLGNLIAVKKGSGKGKRIMLA
AHMDEIGLVASYIDEKGFIRISNIGGINPYVAAGQRVKFHNGITGCVCYEENITDFKDLK
LERMYIDIGTNKREITMECVKPGDMAVFCGETIEQNGRFISKALDDRIGCAILIKLMEKI
EDCPNDIIFVFTVQEEVGLRGAGPAAFAVKPDVAVAVDVTNTGDTPECRPLAIELGKGPA
VMIKDNRTISHPKVKNALIECAEKNGIPYQLEVMSVGGNDAGTIHTAAGGIPAGAVSIPC
RYLHRPCEMVDKNDALNAVKLLEAFVMNPAL
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgatatcattgctgaaggaacttacaaatgcttacggaccctcaggacgggaagacgag
ataagaaatgtaataagggaaaaaatatcttcacgggctgatgaagtttataccgatacg
ctcggaaacctcattgcggtgaaaaagggctcgggaaagggaaaaaggataatgcttgcc
gcccatatggacgaaatcgggctggtggcttcttatattgatgaaaaaggatttatccgc
atttcaaacattggcgggattaacccgtatgtggccgcaggacagcgggtaaaattccat
aacggcataaccgggtgcgtttgctatgaagaaaacataaccgattttaaagatttgaag
ctggaaagaatgtatattgacatcgggacaaacaaacgggaaattacgatggaatgtgtc
aaacccggtgatatggctgttttctgcggtgaaactatagaacagaacggaaggtttata
tcaaaggcgctggatgacagaataggctgcgcaattctgattaaacttatggaaaagatc
gaagactgccccaacgacattatttttgtcttcaccgtacaggaggaagtggggcttcgc
ggcgcaggccctgccgcttttgccgttaagcctgacgtggccgtcgccgtggatgtcacg
aatacgggcgacacacccgaatgcaggccattggcaatagaactgggaaagggcccggcg
gtgatgataaaggacaacaggaccatctcccatccaaaggtgaaaaatgcgctgatagaa
tgcgccgagaaaaacggaatcccgtaccagcttgaagttatgagcgtcggaggaaacgac
gcaggaacaattcataccgctgcgggaggaattcccgcaggtgccgtttcaataccctgc
aggtatctgcaccggccttgcgaaatggtggacaaaaacgacgcattgaatgccgttaaa
ctactggaagcgtttgttatgaatccggcgctttag

DBGET integrated database retrieval system