KEGG   Clostridium stercorarium subsp. stercorarium DSM 8532: Clst_0566Help
Entry
Clst_0566         CDS       T02527                                 

Definition
(GenBank) cellulase
Organism
csd  Clostridium stercorarium subsp. stercorarium DSM 8532
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
622271..623266
Genome map
AA seq 331 aa AA seqDB search
MISLLKELTNAYGPSGREDEIRNVIREKISSRADEVYTDTLGNLIAVKKGSGKGKRIMLA
AHMDEIGLVASYIDEKGFIRISNIGGINPYVAAGQRVKFHNGITGCVCYEENITDFKDLK
LERMYIDIGTNKREITMECVKPGDMAVFCGETIEQNGRFISKALDDRIGCAILIKLMEKI
EDCPNDIIFVFTVQEEVGLRGAGPAAFAVKPDVAVAVDVTNTGDTPECRPLAIELGKGPA
VMIKDNRTISHPKVKNALIECAEKNGIPYQLEVMSVGGNDAGTIHTAAGGIPAGAVSIPC
RYLHRPCEMVDKNDALNAVKLLEAFVMNPAL
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgatatcattgctgaaggaacttacaaatgcttacggaccctcaggacgggaagacgag
ataagaaatgtaataagggaaaaaatatcttcacgggctgatgaagtttataccgatacg
ctcggaaacctcattgcggtgaaaaagggctcgggaaagggaaaaaggataatgcttgcc
gcccatatggacgaaatcgggctggtggcttcttatattgatgaaaaaggatttatccgc
atttcaaacattggcgggattaacccgtatgtggccgcaggacagcgggtaaaattccat
aacggcataaccgggtgcgtttgctatgaagaaaacataaccgattttaaagatttgaag
ctggaaagaatgtatattgacatcgggacaaacaaacgggaaattacgatggaatgtgtc
aaacccggtgatatggctgttttctgcggtgaaactatagaacagaacggaaggtttata
tcaaaggcgctggatgacagaataggctgcgcaattctgattaaacttatggaaaagatc
gaagactgccccaacgacattatttttgtcttcaccgtacaggaggaagtggggcttcgc
ggcgcaggccctgccgcttttgccgttaagcctgacgtggccgtcgccgtggatgtcacg
aatacgggcgacacacccgaatgcaggccattggcaatagaactgggaaagggcccggcg
gtgatgataaaggacaacaggaccatctcccatccaaaggtgaaaaatgcgctgatagaa
tgcgccgagaaaaacggaatcccgtaccagcttgaagttatgagcgtcggaggaaacgac
gcaggaacaattcataccgctgcgggaggaattcccgcaggtgccgtttcaataccctgc
aggtatctgcaccggccttgcgaaatggtggacaaaaacgacgcattgaatgccgttaaa
ctactggaagcgtttgttatgaatccggcgctttag

DBGET integrated database retrieval system