KEGG   Clostridium stercorarium subsp. stercorarium DSM 8532: Clst_0630Help
Entry
Clst_0630         CDS       T02527                                 

Gene name
xynC
Definition
XynC (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
csd  Clostridium stercorarium subsp. stercorarium DSM 8532
Brite
Enzymes [BR:csd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     Clst_0630 (xynC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
693480..696578
Genome map
AA seq 1032 aa AA seqDB search
MNGRNGGKRPIASLLVLTLAFLFIPVTKAETTVYHETFAEGKGAAVQSGGATITHVTGKF
FDGNGDGAALYISNRVNNWDAADFRFSDIGLQDGRIYKITVKGYVDPDVHVPEGSQIWLQ
TVNSYGWWGSTDIKAGEAFTLTGVYKVDTTNDYALRIQSNDTGAFVPFYIGEILITEETV
PQDDSRNGNKTHAEKFTPITFEDQTTGGFTGRAGTEILTVTDEANHTDGGRYSLKVGGRN
DTWHGPALGVEKYVDQGYEYKVAVYVRLISPESAQLQLSTQIGEGTSASYVNLAKKNVAI
SDGWVLLEGTYRYDNLGGGYLTIYVESPDSPEASFYIDDINFEPTGMKSEEIEKGLKSLK
DVYKDNFLTGTAISLRDLEGVRFELLKKHFNAVTAENAMKPSELQREKGNFTFDGADRLV
NAAISAGMKVHGHTLVWHQQTPAWMNIKLDSGGNIVYLSREEALENMRNHIRTVIEHFGD
KVISWDVVNEAMSDNPSNPSDWRGSLRKSPWYYAIGEDYVEQAFLAAREVLDEHPEWDIK
LYYNDYNLDNQNKALAVYNMVRELNEKYQKTHPGKLLIDGIGMQGHYSVNTNPKNVELSL
KRFTELGVEVSISELDIRAGSNYQLTEKEANAQAYLYAQLFKIFREYSDSIARVTFWGMD
DGTSWRAEESPLLFDRTLKAKPAYYAVADPDEFIEKYKPETIEANRAYAVYGTPEIDGKT
DEVWNKAPELKINRYQTAWHGADGTARVLYDENNLYVLIKVNDTQLDKGSPNPWEQDSVE
IFIDENNAKTSFYEEDDGQYRVNFENETSFNPESIAGGFESAAEVSGTNYTLEVKIPFRT
VKPVSNMQIGFDVQINDGKNGVRQSIATWNDPTGNAWQDTSVFGILTLKSKNPVTRGEAI
VKIMKAYDMEPLENWNDNFSDASGSYAGYYARAKETGFVSGIGDNKIGAEIPLTREMFFT
MIYNIERITGKMQGIDISDAELTLFSDYNDLSEWAEEAVKALVKSGRIKINGDLLPKALM
DAEEVEAFLRLR
NT seq 3099 nt NT seq  +upstreamnt  +downstreamnt
atgaatggccgtaatgggggtaaaagacctatagcgagcctgcttgtgctcacacttgca
tttttattcattccggtaacgaaggcagaaacaacggtttatcatgagacttttgccgaa
ggaaagggagcggcggtacagtcaggcggggcgaccattacgcacgttaccggaaaattt
tttgacggcaacggggacggagcggcactgtacatatccaacagagtgaacaactgggac
gctgcagatttcagattcagcgacataggtcttcaggacggaagaatttataaaataacg
gtaaagggatatgtggatcccgatgttcatgtaccggagggttcccagatatggcttcag
accgttaacagctatgggtggtggggcagtaccgacataaaggccggtgaagcctttact
ctgacgggcgtatataaggtggatacaaccaatgattatgctctgaggattcagtccaat
gacaccggagcatttgttccgttttatatcggtgaaatattgatcaccgaagaaacggtt
cctcaggatgacagccgaaatgggaataaaactcatgctgagaagttcacacccataacc
tttgaggaccaaaccacaggcggatttacaggcagggcaggaaccgaaattcttacggta
accgatgaggcaaaccataccgatggcggaagatattcgcttaaagtcgggggaaggaac
gacacatggcatggcccggcgttgggtgtggaaaaatacgtggatcagggttacgaatat
aaagtggcggtttatgtcaggctgatttcacctgaaagtgcacaactgcaactgtcaacg
caaattggtgaaggcacatcggcaagttacgtaaaccttgcgaaaaagaatgttgcaatc
agtgacggctgggttctgctggaaggtacataccgctacgacaatcttggcggagggtac
ctgacaatatatgtggagagccctgacagccctgaggcatcattttatattgacgacatc
aactttgaacccacgggcatgaaatctgaagagattgaaaaaggtttaaaatccttgaag
gatgtgtataaggataattttctcaccggcacggcgatatcattgcgtgacctggaaggt
gtaaggtttgagcttctgaaaaaacatttcaatgcggtaactgcggaaaatgcaatgaag
ccttccgaattgcagcgtgagaagggaaattttacctttgacggggcagacaggcttgta
aacgccgcaataagtgcaggaatgaaagtacacgggcatacgctggtatggcaccagcag
acccccgcgtggatgaatattaagttggatagcggaggaaatattgtatacctcagcagg
gaagaagcgcttgaaaatatgagaaatcatataagaaccgttattgagcattttggcgac
aaggttatatcgtgggatgttgtaaacgaagcaatgagcgacaatccttccaatccttcc
gactggagaggatcactgcgtaaatcgccttggtattatgccattggcgaagactacgtg
gaacaggctttccttgccgcgagagaggtgctggatgaacaccccgaatgggatattaag
ctttactacaacgattacaaccttgataaccagaacaaagctttggctgtttacaacatg
gtaagagaacttaacgaaaaataccagaaaactcatccgggaaaactccttatcgacggt
ataggcatgcagggacattattctgtaaatacaaatccgaagaatgttgaactgtcactg
aagcggtttaccgaactgggtgtggaggtcagcataagcgaactggatatccgtgcgggc
agcaattatcagctcaccgagaaagaggcgaatgcccaggcctacctttacgctcagttg
ttcaaaattttccgtgaatattccgacagtattgcacgggttacgttctggggaatggat
gacggtacaagctggagggcggaagaaagcccgctgctgtttgacaggaccctaaaagcc
aaacctgcgtattacgctgttgcagatccggacgaattcattgagaaatataagcctgaa
acaatagaagccaaccgggcatatgcggtttacggcacacctgaaattgacggaaaaacc
gatgaagtttggaacaaggcacctgagctgaaaattaacaggtaccagaccgcttggcat
ggcgccgacggcaccgcaagggttctttacgacgaaaacaacctgtacgttctgatcaag
gttaatgacacacagcttgataaaggaagcccaaatccatgggagcaggattcggttgaa
atatttatagacgaaaataatgcaaaaacatcattttatgaggaagacgacggccagtac
agggttaactttgaaaacgagacatcctttaatccggaaagtatagccggcggttttgaa
tcggccgcggaagtttcgggaacaaactataccttggaagtgaaaataccgttcaggacc
gtgaaacccgtcagcaatatgcaaatcggatttgacgtgcagattaacgacggaaaaaac
ggagtgcggcagagcattgcaacatggaatgacccgactggaaatgcatggcaggatact
tcggttttcggtattcttactttgaaatcaaaaaatccggttacccgcggtgaagccatt
gtaaaaattatgaaggcttatgatatggaaccactggaaaactggaacgacaatttctcc
gatgcttcgggaagctacgcgggatattacgcgagagcaaaggaaacgggttttgtcagc
ggtatcggggacaataagataggtgctgaaattccgcttacccgggaaatgttttttaca
atgatttataatatcgaacgaataacagggaaaatgcaggggatagatatttcagacgcg
gaacttacacttttcagcgattataacgacttgtcggagtgggccgaagaggcagttaag
gcattggttaaatcaggcaggatcaaaattaacggcgatttattgccgaaggcgcttatg
gacgctgaagaagtggaggcatttttaagattaagataa

DBGET integrated database retrieval system